SILENT KILLERPanel

Current Path: > > usr > > bin >


Operation   : Linux premium88.web-hosting.com 4.18.0-553.54.1.lve.el8.x86_64 #1 SMP Wed Jun 4 13:01:13 UTC 2025 x86_64
Software     : Apache
Server IP    : 185.61.154.216 | Your IP: 216.73.216.44
Domains      : 1034 Domain(s)
Permission   : [ 0555 ]

Files and Folders in: //usr//bin/


Warning: filesize(): stat failed for //usr//bin//easy_install-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //usr//bin//easy_install-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //usr//bin//pip-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //usr//bin//pip-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //usr//bin//pip3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //usr//bin//pip3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //usr//bin//pydoc-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //usr//bin//pydoc-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //usr//bin//pydoc3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //usr//bin//pydoc3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //usr//bin//pyvenv-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //usr//bin//pyvenv-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //usr//bin//unversioned-python in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //usr//bin//unversioned-python in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137
NameTypeSizeLast ModifiedActions
7za File 46 bytes October 04 2024 01:50:29.
GET File 16217 bytes April 22 2022 20:13:06.
Mail File 418704 bytes October 13 2019 00:19:50.
[ File 54960 bytes April 01 2023 08:44:39.
aclocal File 36478 bytes October 14 2023 20:00:43.
aclocal-1.16 File 36478 bytes October 14 2023 20:00:43.
addr2line File 34216 bytes November 15 2024 09:59:32.
animate File 12128 bytes April 01 2025 13:15:58.
ar File 63448 bytes November 15 2024 09:59:32.
arch File 38304 bytes April 01 2023 08:44:39.
arpaname File 12104 bytes February 20 2025 09:05:41.
as File 911264 bytes November 15 2024 09:59:32.
aspell File 163328 bytes April 18 2022 15:10:53.
at File 1036 bytes October 10 2022 10:23:17.
atq File 1038 bytes October 10 2022 10:23:17.
atrm File 1040 bytes October 10 2022 10:23:17.
autoconf File 14768 bytes August 13 2024 19:30:48.
autoheader File 8534 bytes August 13 2024 19:30:48.
autom4te File 32181 bytes August 13 2024 19:30:48.
automake File 257949 bytes October 14 2023 20:00:43.
automake-1.16 File 257949 bytes October 14 2023 20:00:43.
autoreconf File 21066 bytes August 13 2024 19:30:48.
autoscan File 17124 bytes August 13 2024 19:30:48.
autoupdate File 33872 bytes August 13 2024 19:30:48.
awk File 685848 bytes April 18 2022 15:56:05.
b2sum File 59144 bytes April 01 2023 08:44:39.
base32 File 42544 bytes April 01 2023 08:44:39.
base64 File 42560 bytes April 01 2023 08:44:39.
basename File 38392 bytes April 01 2023 08:44:39.
bash File 1154680 bytes August 26 2025 08:48:39.
bashbug-64 File 7348 bytes August 26 2025 08:48:31.
batch File 137 bytes October 10 2022 10:23:17.
bison File 448224 bytes October 12 2019 12:28:39.
bunzip2 File 37744 bytes January 28 2025 01:38:59.
bzcat File 37744 bytes January 28 2025 01:38:59.
bzcmp File 2128 bytes January 28 2025 01:38:58.
bzdiff File 2128 bytes January 28 2025 01:38:58.
bzgrep File 1677 bytes January 28 2025 01:38:58.
bzip2 File 37744 bytes January 28 2025 01:38:59.
bzip2recover File 16832 bytes January 28 2025 01:38:59.
bzless File 1259 bytes January 28 2025 01:38:58.
bzmore File 1259 bytes January 28 2025 01:38:58.
c++ File 1266616 bytes August 26 2025 09:47:24.
c++filt File 29584 bytes November 15 2024 09:59:32.
c89 File 224 bytes August 26 2025 09:45:19.
c99 File 215 bytes August 26 2025 09:45:19.
cagefs_enter.proxied File 1056 bytes May 26 2025 11:13:23.
cal File 67560 bytes April 06 2024 13:02:53.
captoinfo File 87360 bytes October 14 2023 18:54:49.
cat File 38440 bytes April 01 2023 08:44:39.
catchsegv File 3283 bytes August 05 2025 14:01:26.
cc File 1266576 bytes August 26 2025 09:47:26.
chgrp File 67944 bytes April 01 2023 08:44:39.
chmod File 63784 bytes April 01 2023 08:44:39.
chown File 72080 bytes April 01 2023 08:44:39.
chrt File 38072 bytes April 06 2024 13:02:53.
cksum File 38360 bytes April 01 2023 08:44:39.
cldetect File 10600 bytes August 28 2025 09:14:20.
clear File 12840 bytes October 14 2023 18:54:49.
clusterdb File 71920 bytes February 27 2024 08:25:00.
cmp File 106248 bytes May 04 2020 15:15:14.
col File 29696 bytes April 06 2024 13:02:53.
colcrt File 16872 bytes April 06 2024 13:02:53.
colrm File 25480 bytes April 06 2024 13:02:53.
column File 50656 bytes April 06 2024 13:02:53.
comm File 42632 bytes April 01 2023 08:44:39.
compare File 12136 bytes April 01 2025 13:15:58.
composite File 12120 bytes April 01 2025 13:15:58.
conjure File 12120 bytes April 01 2025 13:15:58.
convert File 12120 bytes April 01 2025 13:15:58.
cp File 151600 bytes April 01 2023 08:44:39.
cpan File 8370 bytes June 03 2025 14:32:21.
cpp File 1266552 bytes August 26 2025 09:47:25.
createdb File 71904 bytes February 27 2024 08:25:00.
createuser File 76416 bytes February 27 2024 08:25:00.
crontab File 1524 bytes April 06 2024 11:40:05.
crontab.cagefs File 55464 bytes June 23 2025 12:23:46.
csplit File 55048 bytes April 01 2023 08:44:39.
curl File 235608 bytes January 28 2025 01:43:10.
cut File 50784 bytes April 01 2023 08:44:39.
date File 108576 bytes April 01 2023 08:44:39.
dbiprof File 6206 bytes April 25 2022 16:10:04.
dd File 79920 bytes April 01 2023 08:44:39.
delv File 43480 bytes February 20 2025 09:05:41.
df File 93352 bytes April 01 2023 08:44:39.
diff File 274440 bytes May 04 2020 15:15:14.
diff3 File 131688 bytes May 04 2020 15:15:14.
dig File 166080 bytes February 20 2025 09:05:41.
dir File 143328 bytes April 01 2023 08:44:39.
dircolors File 50816 bytes April 01 2023 08:44:39.
dirname File 34240 bytes April 01 2023 08:44:39.
display File 12128 bytes April 01 2025 13:15:58.
dnstap-read File 20920 bytes February 20 2025 09:05:41.
dropdb File 67608 bytes February 27 2024 08:25:00.
dropuser File 67576 bytes February 27 2024 08:25:00.
du File 109672 bytes April 01 2023 08:44:39.
easy_install-3 File bytes January 01 1970 00:00:00.
echo File 38328 bytes April 01 2023 08:44:39.
egrep File 28 bytes October 11 2019 15:15:56.
enc2xs File 41958 bytes October 13 2019 08:46:10.
enchant File 21584 bytes October 23 2019 20:03:55.
enchant-lsmod File 13408 bytes October 23 2019 20:03:55.
env File 42424 bytes April 01 2023 08:44:39.
eps2eps File 639 bytes June 03 2025 02:48:11.
eqn File 237728 bytes October 13 2019 14:29:41.
ex File 1180368 bytes August 02 2022 16:57:02.
expand File 42664 bytes April 01 2023 08:44:39.
expr File 50840 bytes April 01 2023 08:44:39.
factor File 88120 bytes April 01 2023 08:44:39.
false File 34192 bytes April 01 2023 08:44:39.
fc-cache File 132 bytes August 16 2021 11:04:22.
fc-cache-64 File 20840 bytes October 09 2021 09:02:09.
fc-cat File 16744 bytes October 09 2021 09:02:09.
fc-conflist File 12544 bytes October 09 2021 09:02:09.
fc-list File 12544 bytes October 09 2021 09:02:09.
fc-match File 16648 bytes October 09 2021 09:02:09.
fc-pattern File 12552 bytes October 09 2021 09:02:09.
fc-query File 12536 bytes October 09 2021 09:02:09.
fc-scan File 12552 bytes October 09 2021 09:02:09.
fc-validate File 16648 bytes October 09 2021 09:02:09.
fgrep File 28 bytes October 11 2019 15:15:56.
file File 25272 bytes April 06 2024 14:44:54.
find File 228664 bytes September 24 2024 02:19:34.
flex File 438728 bytes October 12 2019 12:33:17.
flex++ File 438728 bytes October 12 2019 12:33:17.
flock File 33992 bytes April 06 2024 13:02:53.
fmt File 46664 bytes April 01 2023 08:44:39.
fold File 42480 bytes April 01 2023 08:44:39.
free File 21288 bytes October 14 2023 20:31:02.
freetype-config File 4416 bytes March 31 2025 19:37:30.
funzip File 37504 bytes June 03 2025 02:10:12.
g++ File 1266616 bytes August 26 2025 09:47:24.
gawk File 685848 bytes April 18 2022 15:56:05.
gcc File 1266576 bytes August 26 2025 09:47:26.
gcc-ar File 37536 bytes August 26 2025 09:47:26.
gcc-nm File 37536 bytes August 26 2025 09:47:26.
gcc-ranlib File 37536 bytes August 26 2025 09:47:26.
gcov File 1377408 bytes August 26 2025 09:47:26.
gcov-dump File 584664 bytes August 26 2025 09:47:26.
gcov-tool File 622360 bytes August 26 2025 09:47:26.
gem File 542 bytes May 14 2025 12:40:38.
gencat File 25432 bytes August 05 2025 14:12:44.
geoiplookup File 22416 bytes November 28 2019 22:06:01.
geoiplookup6 File 22168 bytes November 28 2019 22:06:01.
geqn File 237728 bytes October 13 2019 14:29:41.
getconf File 33240 bytes August 05 2025 14:12:44.
getent File 33920 bytes August 05 2025 14:12:44.
getopt File 21016 bytes April 06 2024 13:02:53.
ghostscript File 12648 bytes June 03 2025 02:48:22.
git File 3845928 bytes July 23 2025 06:59:57.
git-receive-pack File 3845928 bytes July 23 2025 06:59:57.
git-shell File 2236688 bytes July 23 2025 06:59:57.
git-upload-archive File 3845928 bytes July 23 2025 06:59:57.
git-upload-pack File 3845928 bytes July 23 2025 06:59:57.
gm File 8024 bytes July 29 2024 14:30:44.
gmake File 240968 bytes April 18 2022 16:38:34.
gneqn File 908 bytes October 13 2019 14:29:37.
gnroff File 3312 bytes October 13 2019 14:29:39.
gpg File 1090528 bytes September 13 2022 10:15:05.
gpg-agent File 429352 bytes September 13 2022 10:15:05.
gpg-error File 34976 bytes October 12 2019 12:20:46.
gpg-zip File 3525 bytes September 13 2022 10:15:00.
gpgsplit File 89104 bytes September 13 2022 10:15:05.
gpgv File 462416 bytes September 13 2022 10:15:05.
gpic File 300896 bytes October 13 2019 14:29:41.
gprof File 105840 bytes November 15 2024 09:59:32.
grep File 198280 bytes October 11 2019 15:15:57.
groff File 127920 bytes October 13 2019 14:29:41.
grops File 195728 bytes October 13 2019 14:29:41.
grotty File 145304 bytes October 13 2019 14:29:41.
groups File 38368 bytes April 01 2023 08:44:39.
gs File 12648 bytes June 03 2025 02:48:22.
gsnd File 277 bytes June 03 2025 02:48:11.
gsoelim File 43576 bytes October 13 2019 14:29:41.
gtar File 459768 bytes August 26 2025 08:57:37.
gtbl File 158320 bytes October 13 2019 14:29:41.
gtroff File 824344 bytes October 13 2019 14:29:41.
gunzip File 2345 bytes April 27 2022 05:49:28.
gzexe File 6375 bytes April 27 2022 05:49:28.
gzip File 96944 bytes April 27 2022 05:49:29.
h2ph File 29382 bytes July 28 2025 08:08:32.
h2xs File 60866 bytes July 28 2025 08:07:09.
head File 46672 bytes April 01 2023 08:44:39.
hexdump File 58880 bytes April 06 2024 13:02:53.
host File 145712 bytes February 20 2025 09:05:41.
hostid File 34208 bytes April 01 2023 08:44:39.
hostname File 21664 bytes October 11 2019 13:06:51.
hunspell File 148168 bytes October 13 2019 08:33:15.
iconv File 62912 bytes August 05 2025 14:12:44.
id File 46608 bytes April 01 2023 08:44:39.
identify File 12128 bytes April 01 2025 13:15:58.
idn File 40352 bytes October 13 2019 16:55:35.
ifnames File 4128 bytes August 13 2024 19:30:48.
import File 12120 bytes April 01 2025 13:15:58.
infocmp File 62512 bytes October 14 2023 18:54:49.
infotocap File 87360 bytes October 14 2023 18:54:49.
install File 160000 bytes April 01 2023 08:44:39.
instmodsh File 4194 bytes October 13 2019 08:55:21.
ionice File 29680 bytes April 06 2024 13:02:53.
ipcrm File 29688 bytes April 06 2024 13:02:53.
ipcs File 54672 bytes April 06 2024 13:02:53.
isosize File 25472 bytes April 06 2024 13:02:53.
ispell File 988 bytes April 18 2022 15:10:51.
join File 55056 bytes April 01 2023 08:44:39.
kill File 38168 bytes April 06 2024 13:02:53.
ld File 1789096 bytes November 15 2024 09:59:32.
ld.bfd File 1789096 bytes November 15 2024 09:59:32.
ldd File 5441 bytes August 05 2025 14:01:31.
less File 177928 bytes July 02 2024 20:10:37.
lessecho File 12696 bytes July 02 2024 20:10:37.
lesskey File 22520 bytes July 02 2024 20:10:37.
lesspipe.sh File 3143 bytes July 02 2024 19:57:10.
lex File 438728 bytes October 12 2019 12:33:17.
libnetcfg File 15775 bytes July 28 2025 08:08:32.
libtool File 367724 bytes October 11 2019 14:55:28.
libtoolize File 129197 bytes October 11 2019 14:55:28.
link File 34208 bytes April 01 2023 08:44:39.
ln File 72264 bytes April 01 2023 08:44:39.
locale File 57800 bytes August 05 2025 14:12:44.
localedef File 314848 bytes August 05 2025 14:12:44.
logger File 51184 bytes April 06 2024 13:02:53.
login File 41944 bytes April 06 2024 13:02:53.
logname File 34224 bytes April 01 2023 08:44:39.
look File 16848 bytes April 06 2024 13:02:53.
ls File 143328 bytes April 01 2023 08:44:39.
lynx File 1928720 bytes April 18 2022 21:01:05.
m4 File 190016 bytes October 11 2019 14:41:40.
mail File 418704 bytes October 13 2019 00:19:50.
mailx File 418704 bytes October 13 2019 00:19:50.
make File 240968 bytes April 18 2022 16:38:34.
make-dummy-cert File 610 bytes October 09 2024 13:39:22.
mariadb File 5609880 bytes August 20 2025 21:29:38.
mariadb-access File 112112 bytes August 20 2025 21:29:38.
mariadb-admin File 5126720 bytes August 20 2025 21:29:38.
mariadb-binlog File 5415544 bytes August 20 2025 21:29:38.
mariadb-check File 5123936 bytes August 20 2025 21:29:38.
mariadb-conv File 4819736 bytes August 20 2025 21:29:38.
mariadb-convert-table-format File 4386 bytes August 20 2025 21:29:38.
mariadb-dump File 5229392 bytes August 20 2025 21:29:38.
mariadb-dumpslow File 8382 bytes August 20 2025 21:29:38.
mariadb-embedded File 25641952 bytes August 20 2025 21:29:38.
mariadb-find-rows File 3433 bytes August 20 2025 21:29:38.
mariadb-hotcopy File 35497 bytes August 20 2025 21:29:38.
mariadb-import File 5114768 bytes August 20 2025 21:29:38.
mariadb-plugin File 4794408 bytes August 20 2025 21:29:38.
mariadb-secure-installation File 13993 bytes August 20 2025 21:29:38.
mariadb-setpermission File 18128 bytes August 20 2025 21:29:38.
mariadb-show File 5113080 bytes August 20 2025 21:29:38.
mariadb-slap File 5132592 bytes August 20 2025 21:29:38.
mariadb-tzinfo-to-sql File 4793848 bytes August 20 2025 21:29:38.
mariadb-waitpid File 4781160 bytes August 20 2025 21:29:38.
mc File 1360320 bytes October 18 2019 20:38:40.
mcdiff File 1360320 bytes October 18 2019 20:38:40.
mcedit File 1360320 bytes October 18 2019 20:38:40.
mcookie File 34056 bytes April 06 2024 13:02:53.
mcview File 1360320 bytes October 18 2019 20:38:40.
md5sum File 46712 bytes April 01 2023 08:44:39.
mesg File 16752 bytes April 06 2024 13:02:53.
mkdir File 84776 bytes April 01 2023 08:44:39.
mkfifo File 68160 bytes April 01 2023 08:44:39.
mktemp File 46832 bytes April 01 2023 08:44:39.
mogrify File 12120 bytes April 01 2025 13:15:58.
montage File 12120 bytes April 01 2025 13:15:58.
more File 46016 bytes April 06 2024 13:02:53.
msql2mysql File 1446 bytes August 20 2025 21:29:38.
mv File 147488 bytes April 01 2023 08:44:39.
my_print_defaults File 4785768 bytes August 20 2025 21:29:38.
mysql File 5609880 bytes August 20 2025 21:29:38.
mysql_config File 4574 bytes August 20 2025 21:29:41.
mysql_find_rows File 3433 bytes August 20 2025 21:29:38.
mysql_waitpid File 4781160 bytes August 20 2025 21:29:38.
mysqlaccess File 112112 bytes August 20 2025 21:29:38.
mysqladmin File 5126720 bytes August 20 2025 21:29:38.
mysqlbinlog File 5415544 bytes August 20 2025 21:29:38.
mysqlcheck File 5123936 bytes August 20 2025 21:29:38.
mysqldump File 5229392 bytes August 20 2025 21:29:38.
mysqlimport File 5114768 bytes August 20 2025 21:29:38.
mysqlshow File 5113080 bytes August 20 2025 21:29:38.
mytop File 73681 bytes August 20 2025 21:29:38.
namei File 33896 bytes April 06 2024 13:02:53.
nano File 253888 bytes September 24 2024 02:16:19.
neqn File 908 bytes October 13 2019 14:29:37.
nice File 38312 bytes April 01 2023 08:44:39.
nl File 46720 bytes April 01 2023 08:44:39.
nm File 51584 bytes November 15 2024 09:59:32.
nohup File 38384 bytes April 01 2023 08:44:39.
nproc File 38384 bytes April 01 2023 08:44:39.
nroff File 3312 bytes October 13 2019 14:29:39.
nslookup File 149768 bytes February 20 2025 09:05:41.
nsupdate File 74808 bytes February 20 2025 09:05:41.
numfmt File 67288 bytes April 01 2023 08:44:39.
objcopy File 245832 bytes November 15 2024 09:59:32.
objdump File 429832 bytes November 15 2024 09:59:32.
od File 75656 bytes April 01 2023 08:44:39.
openssl File 763856 bytes October 09 2024 13:39:36.
pango-list File 12160 bytes October 08 2021 15:22:06.
pango-view File 58816 bytes October 08 2021 15:22:06.
passwd File 1044 bytes April 18 2022 22:59:33.
paste File 38360 bytes April 01 2023 08:44:39.
patch File 211416 bytes June 01 2020 15:14:25.
pathchk File 38304 bytes April 01 2023 08:44:39.
pdf2dsc File 698 bytes June 03 2025 02:48:11.
pdf2ps File 909 bytes June 03 2025 02:48:11.
perl File 12728 bytes July 28 2025 08:07:20.
perl5.26.3 File 12728 bytes July 28 2025 08:07:20.
perlbug File 45458 bytes July 28 2025 08:08:32.
perldoc File 118 bytes October 13 2019 11:53:57.
perlivp File 10813 bytes July 28 2025 08:07:09.
perlml File 7024 bytes August 10 2022 20:54:28.
perlthanks File 45458 bytes July 28 2025 08:08:32.
pg_dump File 409016 bytes February 27 2024 08:25:00.
pg_dumpall File 109680 bytes February 27 2024 08:25:00.
pg_restore File 177504 bytes February 27 2024 08:25:00.
pgrep File 29536 bytes October 14 2023 20:31:02.
php File 937 bytes April 03 2025 11:08:35.
pic File 300896 bytes October 13 2019 14:29:41.
piconv File 8271 bytes October 13 2019 08:46:10.
pinentry File 2404 bytes August 12 2018 17:18:10.
pinentry-curses File 79760 bytes November 24 2019 17:39:34.
ping File 67712 bytes October 14 2023 17:19:01.
pinky File 42528 bytes April 01 2023 08:44:39.
pip-3 File bytes January 01 1970 00:00:00.
pip3 File bytes January 01 1970 00:00:00.
pkg-config File 41000 bytes October 13 2019 06:57:31.
pkgconf File 41000 bytes October 13 2019 06:57:31.
pkill File 29536 bytes October 14 2023 20:31:02.
pl2pm File 4533 bytes July 28 2025 08:08:16.
pmap File 33568 bytes October 14 2023 20:31:02.
pod2html File 4134 bytes July 28 2025 08:08:32.
pod2man File 15034 bytes October 13 2019 14:12:32.
pod2text File 10803 bytes October 13 2019 14:12:32.
pod2usage File 3948 bytes October 13 2019 11:57:18.
podchecker File 3658 bytes October 13 2019 11:46:35.
podselect File 2527 bytes October 13 2019 11:52:55.
post-grohtml File 244456 bytes October 13 2019 14:29:41.
pr File 84200 bytes April 01 2023 08:44:39.
pre-grohtml File 133688 bytes October 13 2019 14:29:41.
precat File 5656 bytes April 18 2022 15:10:50.
preunzip File 5656 bytes April 18 2022 15:10:50.
prezip File 5656 bytes April 18 2022 15:10:50.
prezip-bin File 12264 bytes April 18 2022 15:10:53.
printenv File 34200 bytes April 01 2023 08:44:39.
printf File 54928 bytes April 01 2023 08:44:39.
prove File 13562 bytes October 13 2019 12:42:34.
ps File 137984 bytes October 14 2023 20:31:02.
ps2ascii File 631 bytes June 03 2025 02:48:11.
ps2epsi File 2752 bytes June 03 2025 02:48:11.
ps2pdf File 272 bytes June 03 2025 02:48:11.
ps2pdf12 File 215 bytes June 03 2025 02:48:11.
ps2pdf13 File 215 bytes June 03 2025 02:48:11.
ps2pdf14 File 215 bytes June 03 2025 02:48:11.
ps2pdfwr File 1097 bytes June 03 2025 02:48:11.
ps2ps File 647 bytes June 03 2025 02:48:11.
ps2ps2 File 669 bytes June 03 2025 02:48:11.
psql File 659792 bytes February 27 2024 08:25:00.
ptx File 79944 bytes April 01 2023 08:44:39.
pwd File 38400 bytes April 01 2023 08:44:39.
pwdx File 12984 bytes October 14 2023 20:31:02.
pydoc-3 File bytes January 01 1970 00:00:00.
pydoc3 File bytes January 01 1970 00:00:00.
python2 File 8032 bytes April 10 2024 04:58:50.
python2.7 File 8032 bytes April 10 2024 04:58:50.
python3 File 11872 bytes August 26 2025 09:08:24.
python3.6 File 11872 bytes August 26 2025 09:08:24.
python3.6m File 11872 bytes August 26 2025 09:08:24.
pyvenv-3 File bytes January 01 1970 00:00:00.
ranlib File 63464 bytes November 15 2024 09:59:32.
readelf File 639528 bytes November 15 2024 09:59:32.
readlink File 47064 bytes April 01 2023 08:44:39.
realpath File 51216 bytes April 01 2023 08:44:39.
recode File 48160 bytes October 18 2019 15:18:02.
reindexdb File 72008 bytes February 27 2024 08:25:00.
rename File 16896 bytes April 06 2024 13:02:53.
renew-dummy-cert File 725 bytes October 09 2024 13:39:22.
renice File 16856 bytes April 06 2024 13:02:53.
replace File 4763688 bytes August 20 2025 21:29:38.
reset File 25352 bytes October 14 2023 18:54:49.
rev File 12752 bytes April 06 2024 13:02:53.
rm File 72160 bytes April 01 2023 08:44:39.
rmdir File 46632 bytes April 01 2023 08:44:39.
rnano File 253888 bytes September 24 2024 02:16:19.
rsync File 522392 bytes June 03 2025 02:02:49.
ruby File 12128 bytes May 14 2025 12:43:45.
run-with-aspell File 85 bytes April 18 2022 15:10:50.
rvi File 1180368 bytes August 02 2022 16:57:02.
rview File 1180368 bytes August 02 2022 16:57:02.
rvim File 3067760 bytes August 02 2022 16:57:02.
scalar File 2290912 bytes July 23 2025 06:59:57.
scl File 37752 bytes April 01 2023 16:10:31.
scl_enabled File 258 bytes August 25 2017 08:23:02.
scl_source File 1863 bytes April 01 2023 16:10:31.
scp File 105320 bytes February 19 2025 20:59:40.
screen File 494040 bytes May 05 2021 10:04:06.
script File 37672 bytes April 06 2024 13:02:53.
sdiff File 107856 bytes May 04 2020 15:15:14.
sed File 118248 bytes April 18 2022 21:41:04.
selectorctl File 7812 bytes July 11 2025 17:46:23.
seq File 54808 bytes April 01 2023 08:44:39.
setsid File 16768 bytes April 06 2024 13:02:53.
setterm File 46200 bytes April 06 2024 13:02:53.
sftp File 163576 bytes February 19 2025 20:59:40.
sh File 1154680 bytes August 26 2025 08:48:39.
sha1sum File 46720 bytes April 01 2023 08:44:39.
sha224sum File 46752 bytes April 01 2023 08:44:39.
sha256sum File 46752 bytes April 01 2023 08:44:39.
sha384sum File 46760 bytes April 01 2023 08:44:39.
sha512sum File 46760 bytes April 01 2023 08:44:39.
shred File 63424 bytes April 01 2023 08:44:39.
shuf File 59560 bytes April 01 2023 08:44:39.
size File 34048 bytes November 15 2024 09:59:32.
skill File 29488 bytes October 14 2023 20:31:02.
slabtop File 21344 bytes October 14 2023 20:31:02.
sleep File 38368 bytes April 01 2023 08:44:39.
snice File 29488 bytes October 14 2023 20:31:02.
soelim File 43576 bytes October 13 2019 14:29:41.
sort File 126512 bytes April 01 2023 08:44:39.
spell File 122 bytes April 18 2022 15:10:51.
splain File 19150 bytes July 28 2025 08:08:32.
split File 59520 bytes April 01 2023 08:44:39.
sprof File 29360 bytes August 05 2025 14:12:44.
sqlite3 File 1346512 bytes July 29 2025 01:27:56.
ssh File 775720 bytes February 19 2025 20:59:40.
ssh-add File 354432 bytes February 19 2025 20:59:40.
ssh-agent File 333392 bytes February 19 2025 20:59:40.
ssh-copy-id File 10694 bytes February 19 2025 20:59:39.
ssh-keygen File 437416 bytes February 19 2025 20:59:40.
ssh-keyscan File 438856 bytes February 19 2025 20:59:40.
stat File 88304 bytes April 01 2023 08:44:39.
stdbuf File 50768 bytes April 01 2023 08:44:39.
strace File 2029832 bytes January 28 2025 01:32:17.
stream File 12112 bytes April 01 2025 13:15:58.
strings File 38328 bytes November 15 2024 09:59:32.
strip File 245856 bytes November 15 2024 09:59:32.
stty File 79544 bytes April 01 2023 08:44:39.
sum File 46704 bytes April 01 2023 08:44:39.
sync File 38328 bytes April 01 2023 08:44:39.
tabs File 16952 bytes October 14 2023 18:54:49.
tac File 42568 bytes April 01 2023 08:44:39.
tail File 75984 bytes April 01 2023 08:44:39.
tar File 459768 bytes August 26 2025 08:57:37.
taskset File 38144 bytes April 06 2024 13:02:53.
tbl File 158320 bytes October 13 2019 14:29:41.
tclsh File 9256 bytes October 12 2019 00:25:32.
tclsh8.6 File 9256 bytes October 12 2019 00:25:32.
tee File 42552 bytes April 01 2023 08:44:39.
test File 54912 bytes April 01 2023 08:44:39.
tic File 87360 bytes October 14 2023 18:54:49.
timeout File 42936 bytes April 01 2023 08:44:39.
tload File 17160 bytes October 14 2023 20:31:02.
tmpwatch File 36320 bytes October 12 2019 11:32:29.
toe File 16848 bytes October 14 2023 18:54:49.
top File 124616 bytes October 14 2023 20:31:02.
touch File 96272 bytes April 01 2023 08:44:39.
tput File 25392 bytes October 14 2023 18:54:49.
tr File 50896 bytes April 01 2023 08:44:39.
traceroute File 72672 bytes March 11 2025 07:45:53.
troff File 824344 bytes October 13 2019 14:29:41.
true File 34200 bytes April 01 2023 08:44:39.
truncate File 42432 bytes April 01 2023 08:44:39.
tset File 25352 bytes October 14 2023 18:54:49.
tsort File 42568 bytes April 01 2023 08:44:39.
tty File 34192 bytes April 01 2023 08:44:39.
tzselect File 15370 bytes August 05 2025 14:01:06.
uapi File 1040 bytes September 07 2025 00:26:23.
ul File 21072 bytes April 06 2024 13:02:53.
uname File 38304 bytes April 01 2023 08:44:39.
unexpand File 46776 bytes April 01 2023 08:44:39.
uniq File 50912 bytes April 01 2023 08:44:39.
unlink File 34216 bytes April 01 2023 08:44:39.
unversioned-python File bytes January 01 1970 00:00:00.
unzip File 206728 bytes June 03 2025 02:10:12.
unzipsfx File 103912 bytes June 03 2025 02:10:12.
uptime File 12888 bytes October 14 2023 20:31:02.
users File 38368 bytes April 01 2023 08:44:39.
utmpdump File 29344 bytes April 06 2024 13:02:53.
vacuumdb File 80344 bytes February 27 2024 08:25:00.
vdir File 143328 bytes April 01 2023 08:44:39.
vi File 1180368 bytes August 02 2022 16:57:02.
view File 1180368 bytes August 02 2022 16:57:02.
vim File 3067760 bytes August 02 2022 16:57:02.
vimdiff File 3067760 bytes August 02 2022 16:57:02.
vimtutor File 2121 bytes August 02 2022 16:56:59.
vmstat File 37672 bytes October 14 2023 20:31:02.
watch File 29888 bytes October 14 2023 20:31:02.
wc File 50912 bytes April 01 2023 08:44:39.
wget File 533928 bytes August 13 2024 22:22:56.
whereis File 29976 bytes April 06 2024 13:02:53.
which File 30088 bytes August 26 2025 08:54:45.
who File 54968 bytes April 01 2023 08:44:39.
whoami File 34216 bytes April 01 2023 08:44:39.
word-list-compress File 12280 bytes April 18 2022 15:10:53.
x86_64-redhat-linux-c++ File 1266616 bytes August 26 2025 09:47:24.
x86_64-redhat-linux-g++ File 1266616 bytes August 26 2025 09:47:24.
x86_64-redhat-linux-gcc File 1266576 bytes August 26 2025 09:47:26.
x86_64-redhat-linux-gcc-8 File 1266576 bytes August 26 2025 09:47:26.
xargs File 75888 bytes September 24 2024 02:19:34.
xmlcatalog File 20864 bytes August 06 2025 13:59:35.
xmllint File 75128 bytes August 06 2025 13:59:35.
xmlwf File 33752 bytes April 15 2025 19:58:56.
xsltproc File 29152 bytes August 26 2025 08:55:17.
xsubpp File 5080 bytes October 13 2019 08:58:35.
xxd File 21016 bytes August 02 2022 16:57:02.
yes File 34248 bytes April 01 2023 08:44:39.
zcat File 1983 bytes April 27 2022 05:49:28.
zcmp File 1677 bytes April 27 2022 05:49:28.
zdiff File 5879 bytes April 27 2022 05:49:28.
zegrep File 29 bytes April 27 2022 05:49:28.
zfgrep File 29 bytes April 27 2022 05:49:28.
zforce File 2080 bytes April 27 2022 05:49:28.
zgrep File 7582 bytes April 27 2022 05:49:28.
zip File 234496 bytes October 11 2019 13:11:04.
zipcloak File 105376 bytes October 11 2019 13:11:04.
zipgrep File 2953 bytes October 10 2008 17:40:36.
zipinfo File 206728 bytes June 03 2025 02:10:12.
zipnote File 100104 bytes October 11 2019 13:11:04.
zipsplit File 100104 bytes October 11 2019 13:11:04.
zless File 2205 bytes April 27 2022 05:49:28.
zmore File 1841 bytes April 27 2022 05:49:28.
znew File 4552 bytes April 27 2022 05:49:28.
zsoelim File 43576 bytes October 13 2019 14:29:41.

Reading File: //usr//bin//script

ELF>�=@h�@8@@@@hh����l�l �v�v �v 	`	 {{ {   ���  ���DDS�td���  P�tdggg��Q�tdR�td�v�v �v 		/lib64/ld-linux-x86-64.so.2GNU�GNUGNU���
�mj����X{��=?k9�V
 VWZ)��Pv��bA�9�2����9 Zd�=��� mK��]y��Q*T&��,ix������N]��KDC�( wX^h'J��p�����d��5t.<L���7 ���"�(� i � �! � G@� �0� @8� librt.so.1_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTablelibutil.so.1openptylibutempter.so.0utempter_remove_recordutempter_add_recordlibc.so.6fflushgmtime_r__printf_chkexeclsetlocalestrncmpoptindstrrchrcfmakerawdcgettextnanosleepsignalforkwarnxsigprocmask__stack_chk_failabortstrtoll_exitgetpidkillstrspnstrftimelocaltime_risattyexeclpfdatasyncstrlensignalfdsigemptysetwarn__errno_locationtcsetattrreadstrndupdup2strptimepoll__fprintf_chksigaddsetstdoutfputcfputsfclosestrtoulgetgid__lxstat64getenvoptargstderrioctlwait3__snprintf_chkgetuidgetegidgetopt_longstrncasecmpfwritegettimeofdaygeteuidclock_gettime__fpending__vfprintf_chkmktimeprogram_invocation_short_nametcgetattr__cxa_finalizesetsiderrxfopen64bindtextdomainaccesssysinfostrcmp__libc_start_mainferrorfree__progname__cxa_atexitGLIBC_2.2.5UTEMPTER_1.1GLIBC_2.7GLIBC_2.4GLIBC_2.17GLIBC_2.3.4Q ui	�f A�
��ii
�ii
�����ti	�ui	��v �>�v `>w w  w q`@w x``w �`�w �`�w �`�w �`�w �`x �] x ^`x 0epx "f�x Jf�x \�x )f�x 1f�x 8f�x <f�x Cf�x Ify Nfy Qf y Sf0y Yf@y ^fPy o^`y afpy �f�y �^�y ff�y lf�y �_�y qf�y wf�y �f�y |fz �fz 4` z =e0z �f@z �fPz �f`z �fpz �f�z �f�z �f�z �f�z �f�z �f�z �f�z �f�z �f� 
� .� 3� O� S � W(� V0� Z8� [@� Y8} @} H} P} X} `} h} p} x} 	�} �} �} 
�} �} �} �} �} �} �} �} �} �} �} �} �} ~ ~ ~ ~  ~ (~  0~ !8~ "@~ #H~ $P~ %X~ &`~ 'h~ (p~ )x~ *�~ +�~ ,�~ -�~ /�~ 0�~ 1�~ 2�~ 4�~ 5�~ 6�~ 7�~ 8�~ 9�~ :�~ ;�~ < = > ? @  A( B0 C8 D@ EH FP GX H` Ih Jp Kx L� M� N� P� Q� R� S� T� U��H��H��` H��t��H����52^ �%3^ ��h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h	��Q������h
��A������h��1������h��!������h
��������h��������h������h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��������h"�������h#�������h$�������h%�������h&�������h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��������h2�������h3�������h4�������h5�������h6�������h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?������h@�������hA��������hB�������hC�������hD�������hE�������hF�������hG��q������hH��a������hI��Q������hJ��A������hK��1������hL��!������hM��������hN��������hO������hP��������%Y D���%Y D���%
Y D���%Y D���%�X D���%�X D���%�X D���%�X D���%�X D���%�X D���%�X D���%�X D���%�X D���%�X D���%�X D���%�X D���%�X D���%�X D���%�X D���%�X D���%}X D���%uX D���%mX D���%eX D���%]X D���%UX D���%MX D���%EX D���%=X D���%5X D���%-X D���%%X D���%X D���%X D���%
X D���%X D���%�W D���%�W D���%�W D���%�W D���%�W D���%�W D���%�W D���%�W D���%�W D���%�W D���%�W D���%�W D���%�W D���%�W D���%�W D���%�W D���%}W D���%uW D���%mW D���%eW D���%]W D���%UW D���%MW D���%EW D���%=W D���%5W D���%-W D���%%W D���%W D���%W D���%
W D���%W D���%�V D���%�V D���%�V D���%�V D���%�V D���%�V D���%�V D���%�V D���%�V D���%�V D���%�V D���%�V D���%�V D�;���f.����AW�5AVAUI��H�5�6ATA��USH��dH�%(H��$1�H��$�H���H��DŽ$����DŽ$�����8���H�5@2��'���H�5�3H�=�3���H�=�3�h���H�=1��1H�=�3�0����fV ��u>1�H��t;H��H�t$1��?���H�|$��H��tH�5�3��������D؉#V ��uM��L�5�9���
V E1�H�
�L L��D��H�4�U����������V��*�JIc�L�>���!���A�����A9��g����U ����H�=�U �L��3��H��51������U �^�����$h �c���H�UU H��tH��$���$h�B�����$h�5���H�U �H�5�21��L���H��H������H�-�T �1�H�5�2�'���H��H�߾H��1��R���H�޿
�5����H�5i51���H��H������H�5R21�����H��H������H�5]51����H��H���k����H�5!21�����H�521�H�����I��L�2H�$2H��H�5&2�1������H�521��H����H�'2H��1����1��;�����$h�����$h���H��S H��$�������$h���H��S �H�511������H�
1H��H��1��-���1�����H�_S �H�5�51����H�=eS �H��H��1����������d���A�����A9�������9S ����HcS A)�E����I�D�H��$�H�==1����H����1�H��$������������$h��	Ј�$h�@��H�uDH�}@E1�1�1�����H�5�0���k������$h���@t2L�d$@H�|$@�H��$$�L������L��1�1��d$L��)�����$H���1����H������H�������H�������H�������H������H�����H�� H��1�����H�ރ�������$p���
��Q �H�=�Q ���m�����$����n���?1��D$���H�|$&�H�5k.H�D$1���$h󪋄$pf�D$$H��$�f�D$,�D$ ��$f�D$4�D$(H�#.HD����H��$�H���c��$h���H�|$�H��$�H����)�H�5�/1���H��$�H�پH��1�����H�}0�M��P ����$h�8	�����$L�d$ �L����������I��D�0�]P �%���[A���H�H�5K/1��V���H��1���H���L�eT1�L�������H�53���ML���1��T1�L�����H�uDH�}@M��L��1�����������H�=�O L�
�+L��-��H�>+�1�������$H�=�-1��\���H��$��H�5�-1���H��H��1������$h���H�x-�>���H�5[-H��$���$h ����L�d$@�L���"��������D$X%�=�tH�|$P����H��$��H�5r11����H��H��1��1�H�5(-1����H��1�����j�H�=�N L�
-L��,��H�
*�1�������$pH�=�,1��+
������$1�1��T�L��$�P��$p�D��$1����$����$��t��$��H��$��/DŽ$����H���x�H��tH�X1�H�� ��|�1���0�H��$���n�����ulH��$�H��$�H����E1�H�,H������H��$��H�5�+1��d�H��H��1���H����H�5�+���H��$�H���1�H�5�+H��1��j�������L I��fC�|�tW����I���LC�D��#��L C�D�u�|$t#����C�D�����M����A��I��I��������C�H�=\L L�
R+L��*��H��'�1���H�=4+1�������H�=L L�
+L�A*��H��'�1��g��H�=�*1���
���H��$�H���8H�5�(H����H��$�H����H��$�����������$h@t
1�H���IH��$��H�5M*�5���D�t$ �pK �wH�t$@��D����H=���H������A�E��t	���	����+K I���>������H�=
K L�
*L�1)��H��&1���W�C�D�H�
�'L�
�*L��*C�T��LEɨH�
�'LE�H�
�'�H��*HD�I�GH���8H��H�5*H��'HE�H�=�-1��N	���A�}u%H�D$1�L��H�D$�����H�����CJ ��������	�H�="J L�
)L�I(��H��%�1��o�H�=�)1�����I �O���1�H�5�(H��1��S�����1�H��(H��1��K��g�����$h@�'���1�H���^	����H��&���C�t�H�T$H���[
�����D$@�����F�H�
�-Hc�H�>��[I ���3��$h@����H����T1�1�H���@�H�ھT1���$�*��I ���������H�=�H L�
�'L�'��H�y$�1��<�D��H�=�(1�������H ��D$H�������|$h�i�����$�[�����H ���N�����R��gH �I��$��4��JH �����>H ���H�5�'1��I�H�=H �H��1��s��$������G �������H�=�G L�
q&L�&��H�e#�1��(�D��H�=\'1���D����}�H�=�G L�
�&L��%��H� #�1����H�=�&1��E�kG ����H�5�$��������H��$�tX1�H��$��<���H�|$H�ھH�D$� �H�5!'1��-�H��$�H�پH��1��S�H�����$��f�D$Ff�D$D�D$@�D$��E1�L�|$@L�t$� 1�L��A��H�D$H�D$����5��
�L���#��yF ����uS��A������t��0�H�=IF L�
E"L�p$��H��!�1���H�={%1���n�����A��tK�������H�=�E L�
�!L�$��H��!�1��C�H�=>%1����E ��t=��H�=�E L�
�!L��#��H�8!�1���H�=%1��]�L�d$L�|$D��$A�EH��L��D��� �H��~H)�����I�A�}u�����A�E��t	�����A�}u�������H�=	E L�
!L�0#��H�� �1��V�H�="$1��������D ���p��$h���t=��H�=�D L�
�#L��"��H�5 �1���H�=�$1��Z��$h�&���H�uPH�}L��J�����0�H�=ID L�
�"L�p"��H���1���H�=�'1��������H�=D L�
�"L�."��H��1���T�1�H�=�#���$h@��������H�uPH�}L1����C DŽ$
�����y�H�=�C L�
("L��!��H��1�����T$h�t$H1�H�=�&�9����/�H�=HC L�
>"L�o!��H���1���H�=H"1���C �H������H�=C L�
�!L�'!��H���1��M�H�=�"1���u�����H�=�B L�
T!L�� ��H�H�1���H�=&1��m�������1�I��^H��H���PTL��H�
OH�=H���A �H�=B H�
B H9�tH��A H��t	�����H�=�A H�5�A H)�H��H��H��?H�H�tH��A H��t��fD�����=�A u+UH�=jA H��tH�=~8 �i��d�����A ]������w����ATUSH����H��I����H�߉��o���u#��tM��u8���8	������[]A\�D��u�o�H�¸�����: t���ظ������H���H�t$(H�T$0H�L$8L�D$@L�L$H��t7)D$P)L$`)T$p)�$�)�$�)�$�)�$�)�$�dH�%(H�D$1�H��H��$�H��H�=�@ H�D$�H�D$ �$�D$0H�D$��H�5q@ �
���H�D$dH3%(uH������f.�H��X�oGT�oOddH�%(H�D$H1�H����oWtH��)$H�D$0���1�)L$)T$ �D$8���H�D$HdH3%(uH��X��%�DUSH��H����?  ������@t�H���b�������u0H�{t)H�k�H�551����H��H��1����{@��x�;��{L��>�H�{(H��t
�������H�{H��t
����������t"�CP�ƒ�������������7�1��0����H�=�> L�
yL���H�n�1��1�H�=i1������H�S H�5q�1����H�SH�5Z�1��������SH���q>  u1���G�H�������*�H�=C> L�
�L�j��H���1���H�=�1����AUI��ATI��US�Ӄ�H��dH�%(H�D$1���=  uRH�l$�	A9$t21҉�H��������H�D$dH3%(udH��[]A\A]���D$A�E��fD�k�H�=�= L�
L����H��1����H�=?1��3����l�����f���ATUSH�= H����H��I����H�߉����Å�����t�1��M��uJ��	uEH��< H���f�H��I���{�H�߉����������tM��u6����8	u,[]A\Ð�� t���tA1��H�5����H��1������������uŃ� �w����1��H�5O��H��1��������u��g��8 t���f.�AWAVAUATUSH��H�$H��H�$H��8dH�%(H��$( 1�I��A��I���; �	A�EH�l$ � D��H���$�H��H������E�����; �����E�f@L�l$I��A�H��H��D���3�H���:A�H)��NHŃ�u�H�D$1�L��H�D$��������A�EH��$( dH3%(�'H��8 []A\A]A^A_��������tă�t�L���_�������H�=�: L�
�L����H�F�1��	�D��H�=�1��h������E9f@�^����|: ���A�������I�~(tm���,H�|$��H�L$L�D$I+N0M+F8yH��I��@BI�~(1�I��H����u�A�����foD$��9 A)F0����t=���H�=�9 L�
�L����H�]�1�� �H�=*1����I�FI��I��H�$���I��H�D$H�D$f�H�$L��L��A�$���H����A�$I)���Iǃ�u�H�D$H�|$1�H�D$��������fDA���t	�����������������uH�D$H�|$1�H�D$������A�~@����������H�=�8 L�
�L����H�F�1��	�H��H�=�1��h�������[��H�=t8 L�
pL����H���1���1�H��H�=t� ����F8 ������
��H�=&8 L�
"L�M��H���1��s�1�H�=F������7 A�����������@A�$��t	���Y���=����r������uH�D$H�|$1�H�D$����=��A����G��7 ��L�l$DA�$H��H��� ��H��~A�$H)�tJH�u���A�$��t	���I��u�H�D$1�L��H�D$���������uH�D$H�|$1�H�D$��������6 ��������H�=�6 L�
�L����H�F�1��	��H�=g1��k����n���fD�[��H�=t6 L�
pL����H���1����H�=�1��#�������fDI�~������I�~(�q���%������H�=6 L�
L�7��H���1��]��H�=B1�������%����5 t=���H�=�5 L�
�L����H�J�1��
��H�=D1��o�H�5K1����H��1��������H�5N��f.�D��S1�H��H��dH�%(H��$�1�H�|$�����t.�I�����H��$�dH3%(����H�Ġ[�H���������uUH��S㥛� H�t$H��H��?H��H�D$H��H)�H�t$H+4$H)�H�3H�Cy�H��H@BH�3H�C�x���DH�|$ ��������V���H�D$H+D$ H�CH��E������D��SH���H�� dH�%(H�D$1�H����������u+H�$H�t$H��S㥛� H�H��H��?H��H��H)�H�SH�|$dH3<%(��uH�� [��)��f�AWH��AVAUATU1�SH��HH�t$(dH�%(H�D$81�H�D$0H�D$ H�D$DH��H�5~H�L$����H�L$H��;�����H�t$�
H���I�����H�D$A�$���qH�|$�iH�l$0�}.�H9���H�D$E1�H��H�5�L�%(+ 1��A��L�-�H�H�l$0�������M�,$I��M��t�L�����I��H��t�H��t�H��L��H��������u�L��H�t�H��H��* H�T$H�tH��E��t!f.�H���������H��H��A��u�L�|$�L��M�,Ll$ ���D���H�t$8dH34%(u~H��H[]A\A]A^A_�@H�]H�t$�
A�$H�����H�D$A�$��H�|$xH�l$0H9�t�A��A)������둸���늅�t�H�D$(H�t$ H�01��r���������AWAVI��1�AUATUH��SH��dH�%(H��$�1�H�\$PH�D$@H�D$H�d��H�|$8H��H�D$8����L��H�=���D$p�����������H�=L��������#�
H�=�L���������	H�=�L��������A�<+�<-�.L������H���<A�|� agoH�p��)L�����I��H���8H�t$HL�����L��$�]���$��xFfDH�����H�D$8H�����Hi�@BH�L$HHD$@H��H)�H9��HB�H�E1�H��$�dH3%(��H�Ę[]A\A]A^A_���l$\H�D$P�D$X�u���D�D$\H�D$P�D$X�U���DH�t$@I�~�������:����u���DH�t$HI�~����������U���DH�$H�5RE1�I��M����L���~��H��H����H��L��L���d������L��H����8 ��E��H��( I��H�$I��O�t>F�d(�D$TH��L��D�|$PH�5�D�l$X�$�D$\�D$�D$`�D$ �D$d�D$(�D$h�D$,�D$l�D$$H�D$xH�D$H��$�H�D$�&��H��t	�8���$H��H�5�L��D�|$P�D$T�D$D�l$X�D$\�D$ �D$p�����D$`�D$(�D$d�D$,�D$h�D$$�D$lH�D$H�D$xH�D$H��$����H��t	�8�H�$H��H�54L��D�|$P�D$T�D$D�l$X�D$\�D$ �D$p�����D$`�D$(�D$d�D$,�D$h�D$$�D$lH�D$H�D$xH�D$H��$��6��H��t	�8���$H��H�5�L��D�|$P�D$T�D$D�l$X�D$\�D$ �D$p�����D$`�D$(�D$d�D$,�D$h�D$$�D$lH�D$H�D$xH�D$H��$����H��t	�8�P�$H��H�5bL��D�|$P�D$T�D$D�l$X�D$\�D$ �D$p�����D$`�D$(�D$d�D$,�D$h�D$$�D$lH�D$H�D$xH�D$H��$��F��H��t	�8�H�$H��H�5�L��D�|$P�D$T�D$D�l$X�D$\�D$ �D$p�����D$`�D$(�D$d�D$,�D$h�D$$�D$lH�D$H�D$xH�D$H��$�����H��t	�8���$H��H�5KL��D�|$P�D$T�D$D�l$X�D$\�D$ �D$p�����D$`�D$(�D$d�D$,�D$h�D$$�D$lH�D$H�D$xH�D$H��$��V��H��t	�8���$H��H�5�L��D�|$P�D$T�D$D�l$X�D$\�D$ �D$p�����D$`�D$(�D$d�D$,�D$h�D$$�D$lH�D$H�D$xH�D$H��$�����H��t�8tt�$H��H�5�L��D�|$P�D$T�D$D�l$X�D$\�D$ �D$p�����D$`�D$(�D$d�D$,�D$h�D$$�D$lH�D$H�D$xH�D$H��$��j��H��t4�8u/�D$PH��� ��H�D$8H���tE���c���D9d$h�X�������w����I��I��tL��H�L$ H��L�,����H�$A������h���H�D$P�D$X노��#����~��ff.����W 1���x�G(�ff.�@AVI��AUI��ATI��U�Ճ�SL����������#@���EM��L�[@��u @��u��uD1�[]A\A]A^�L�<H�����H��L��1���p��H�H9���H)�Iă�t�L���B����ų��H�����������L���ȉ��D�
��A��A)���)�L�����H�����)�k�<)Ѻ���1�)�1�QH���������ZYH�H9��;���f��H�5l1����H��1��c��������
���f�H��tˉ�� ���H��I����̃�TA�D$�@�������A�EE�MH��L��L��
H������PA�EP1��F��^_H�H9��i���H)�I��u���fD�GHcWH��L��
H�����P�GL��lL����P1�����AXAYH�H9�����H)�I��������AVI��AUI��ATA��USH��H��@dH�%(H�D$81�H���@H��tA�t��H��t?H�sM��L��D��H�����H�L$8dH3%(uDH��@[]A\A]A^�D����뽐H��H�5
1��z��H��H��1�����������������I��H�щ�1�����ff.�f���AVI��AUI��ATI��U��SH��@dH�%(H�D$81�H���@H��t:���H��t@M��L���1�H�����H�L$8dH3%(uEH��@[]A\A]A^Ð�����f��H�591����L��H��1�������������@��AWI��AVA��AUI��ATM��USH��H��dH�%(H�D$x1�H�>��H��L��H���t��H�t$@H���g���D$\9D$�D$TtY9D$uYA��H��tzH��L��L�������������H�T$xdH3%(��H�Ĉ[]A\A]A^A_��9D$tBH��H�jL��L���E���1�H���V���O����H�FL��L������@H���L��L��D$H�����L��
PD�L$1����ZYH�L9��������H����a�����AWI��AVI��AUA��ATL�%� UH�-� SL)�H���g��H��t1��L��L��D��A��H��H9�u�H��[]A\A]A^A_�ff.����f.����H�E 1������H��H���MISC%d: %s: %8s: done!Script done, file is %s
write failed: %sfail!waiting for childwrite errorIO%d FD active stdin --> master %zd bytes master --> stdout %zd bytes writing output  writing timing info%ld.%06ld %zd
  writing to script file  writing to output  writing output *failed*write failed  writing output *done*cannot write script fileaewe/dev/stderrPOLLERRPOLLHUPPOLLINstdinsignal/usr/share/localeutil-linuxSCRIPT_DEBUGall%s from %s
util-linux 2.32.1
Usage:
 %s [options] [file]

Options:
display versiondisplay this help -V, --version -h, --help%-31s%s
%-31s%s

For more details see %s.
script(1)ac:efqt::VhtypescriptSHELL/bin/shopenpty failedmaster fd: %dScript started, file is %s
cannot set signal handlerSIGNALsignal fd=%dfork failed-c-ifailed to execute %scannot open %sScript started on %s
POLLcalling poll()poll() rc=%dpoll failedsetting die=1 ignore FD waiting for empty slave   slave is not empty   slave is empty now sending EOF to master  ignore STDINsignal FD %d active resume get signal SIGWINCH
Session terminated.
signal handle on FD %d donepoll() done
Script done on %s
appendcommandreturnflushforcequiettiming%d: %s: don't print memory addresses (SUID executable).
Make a typescript of a terminal session.
 -a, --append                  append the output
 -c, --command <command>       run command rather than interactive shell
 -e, --return                  return exit code of the child process
 -f, --flush                   run flush after each write
     --force                   use output file even when it is a link
 -q, --quiet                   be quiet
 -t[<file>], --timing[=<file>] output timing data to stderr or to FILE
Try '%s --help' for more information.
output file `%s' is a link
Use --force if you really want to use it.
Program not started.failed to get terminal attributes active pfd[%s].fd=%d %s %s %s get signal SIGCHLD [ssi_code=%d, ssi_status=%d] child stop by SIGSTOP -- stop parent too get signal SIG{TERM,INT,QUIT}h��������������������������������[�����G�����:��-��������������������������������������������������������������������������������C��C��\��\��\��\��\��\��\��\��\��\��\��C��\�����\��\��\��\��\��\��\��\��\��\��'��seconds 	

Sundaytodayyesterdaytomorrow%y-%m-%d %H:%M:%S%Y-%m-%d %H:%M:%S%y-%m-%d %H:%M%Y-%m-%d %H:%M%y-%m-%d%Y-%m-%d%Y%m%d%H%M%S%4ld-%.2d-%.2d%02d:%02d:%02d.%06ld,%06ld%+03d:%02dtime %ld is out of range.%b%d/%H:%M%Y-%b%dsecondminutesminuteminmonthsmonthmsecmsmhourshourhrdaysweeksweekyearsyearusecusSunMondayMonTuesdayTueWednesdayWedThursdayThuFridayFriSaturdaySatformat_iso_time: buffer overflow.;�����8 ��0����������P ��|���p�������0�����( ��X�� ��Dp�h��� �@�`���0����0�������zRx����/D$4ض�� FJw�?:*3$"\л��(tX��mB�A�A �{
ABF�����G��
A�`��kD`a
A����XA�A�G ����`A�8<���B�E�D �A(�I@M
(A ABBH,L���F�A�A ��
ABBT|����B�B�B �B(�A0�A8�G� L�@I�@
8A0A(B BBBH0�x����F�G�B �L(�D0�A8�G�$zRx��������,��� D���E�L�J
AD h��wE�L0_
AAL��0B�E�B �B(�A0�C8�D��
8A0A(B BBBEL���rF�B�G �B(�A0�D8�G��
8A0A(B BBBH,�`@�B�E�E �D(�F0�
(A BBBDG8W@M8A0�8E@H8A0u8V@I8B0@����F�E�E �D(�A0�GpN
0A(A BBBF�D�@�P��F�E�E �D(�C0�DpK
0A(A BBBB`@��OF�E�E �E(�D0�A8�J��
8A0A(B BBBIL�^�M�A�D���eF�E�E �E(�H0�H8�G@n8A0A(B BBB������>`>w q`ax`c�`e�`f�`��`q�`t�]V^h0e@B"f@BJf@B\@B)f��1f��8f��<fzKLdCfzKLdIf�Nf�Qf��Sf���Yf���^f���o^���af`��f`��^`�ff��Ќlf��Ќ�_��Ќqf����wf�����f����|f�f4`@B=e�f�f�f�f�f�f�f�f�f�f�f�f�fQf��
�[�v �v ���o0p
� } �00	���o���o����o�o����o6{  0@P`p��������    0 @ P ` p � � � � � � � � !! !0!@!P!`!p!�!�!�!�!�!�!�!�!"" "0"@"P"`"p"�"�"�"�"�"�"�"�"## #0#@#P#`#p#�#�#�#�#�#�#�#�#$GA$3a1��=GA$3p1113 )�[GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA!
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*GOW*� )/[GA* )�JGA$3a1�=�[GA$3p1113�J�[GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA!
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*�JgLGA*GOW*�GA*pL�[GA*0[�[GA*GOW*GA*GOW*�[�[
GA*FORTIFY�>�[GA+GLIBCXX_ASSERTIONS
GA*FORTIFY�J�[GA+GLIBCXX_ASSERTIONSscript-2.32.1-46.el8.x86_64.debuge���7zXZ�ִF!t/��q]?�E�h=��ڊ�2N��X� �.��G�'e�~� �wUH�
��Ӛ�҅Ƞ��|:[���H���2�r�od����9T�,��;%Ä�e��P�Z,��������bb�k��O�R��+����l�;�y���G�W��Ձ'<{��e�R�yPl���
m�|���ڛ�E
U�tWL���z�����{=(-��'\l�<LuX�6_j	%!�T�w�;ǐ˵f]T5˦�|�E�'�o���GϘ2g8��7�Ǧ�)!m�F+�`��:��n	�����@��n"��’$��y���~[��5�j`d��Ս
k��ը�#����̥��_�>�;��x:f6*�f�RD�b�n¼��O�J0\BU���{���g,{���Ti�C1�@�b�g_�rp�Twx�>m�)��i�,G@��0O�Z�
w��Z�����M'瞪CH�`^�^�Wr�jr���,�Z�ه@���.$mɉ#�8���U�qɣ2����S���k�3� ]�,�X�v�����*6A$�/�C̔0B7�ްWs�C�9��-9�b��(\�@0�� �-��#~�q'���p +���"��h<�^��m��ǰ"�G��DE�'+�
�9�����p���̟'5����]]e���$k�jp��n�0(�,r1v���e>JHm�n�kI$�K�6O��3ɳ���j��/�=��Wρ���ƭ
���m>��z$>k����ɋv
���a8Y��c}�����RWB;��h���O����o1�`�s���;��k��>e2K:�i����
�hɽ3)���c�!��	�P��o�>����l�P�+�<N_��o!�Q
A��c�-j�	smX�ݮ��"��6o#�Qѝ57|Y���8����s�Z��V$���6a��R�a����rٸ���2BV��+"β84�����|3��@vm������qyȨ��YA/��6�O��4B�D�7��kqd�O?)V�����z"!�8�j�_���08L�1>����)��%��:�IF9�bm��^�%7TYW������ӽ�Ub�@G�?aW'�'&�!6B([��'@�	�%������g�YZ.shstrtab.interp.note.gnu.property.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdata���� &�� 4$G���o00<Qpp�Y�a���o���n���o���}00�B00������� �$$� ) )�2��[�[
��[�[(�gg���g�g��v �v��v �v�w w �{ { � }  }��� � � �0 
P�`�H L�(/t��(�>

SILENT KILLER Tool